Conserved Protein Domain Family
Phage_holin_3_1

?
pfam05106: Phage_holin_3_1 
Phage holin family (Lysis protein S)
This family represents one of a large number of mutually dissimilar families of phage holins. Holins act against the host cell membrane to allow lytic enzymes of the phage to reach the bacterial cell wall. This family includes the product of the S gene of phage lambda.
Statistics
?
PSSM-Id: 398669
Aligned: 27 rows
Threshold Bit Score: 82.2431
Threshold Setting Gi: 145577191
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013203207   3 DKDPGYWASLIAWLYAHRNE---SGYAALAGAMALLRASYFGKd-TWPRRLMDAAMCSIFAFFVKPTLQVVisifgwNIG 78  Erwinia billingiae
ACQ67609       5 EKEPGFWVALLAWIRGHQAD---FGYASLAALFSLWRNAWGKH--AWSRRLLDALSCSTLAFFSQPLLMMVeglfhgTLP 79  Candidatus Hami...
WP_012738124   5 EKEPGFWVALLAWIRSQQID---FSYASLAALFSLLRNAWGKY--SWSRRLLDAFSCGTLAFFAQPLLSIVdsafdvSLS 79  Candidatus Hami...
WP_024912602   3 slkSDVISLIIPRACEYIQP---LIHAILAGVMALLNGAYRNM--KIRKCLLNACICALLAVTVRDLLSLI------GVK 71  Chania multitud...
WP_004248367   2 KENPDLWEQICIVLYSMKEQ---GISALLAGGMAILRSLYNAG--GWKKTFLDGLMCAMFAWFIKDILLLF------SIN 70  Proteus
CBJ80334       2 KENPDVWVHLGEWLISVREQ---GIWATLAGTMAFFRGRYNGG--GWVKVSIDAFMCAMFAWFIRDVLNFM------GLN 70  Xenorhabdus bov...
P03705         1 -mkmpekhDLLAAILAAKEQ---GIGAILAFAMAYLRGRYNGG--AFTKTVIDATMCAIIAWFIRDLLDFA------GLS 68  Escherichia vir...
Q7N0Y0         5 DKQPDIWMQLWLWLLSVKEQ---GIGAALAAAMAYLRGRYNGG--KFWTTIMDSIMCAMIAWFIRDALNFF------GMS 73  Photorhabdus la...
ACQ68282       1 --mPNFCQTLLDILKHR------IIGAALAFMTALLRGLYQKK--SFNCSLLDALMCALFGSVAHELLLFL------GMK 64  Candidatus Hami...
P44188         3 iKEPDVWALIWSWLQTNLSSssaQSAF-WALFISLLRFGFMRKkpAIRYVLIDAAMCASIAGVAVPICTHL------FGH 75  Haemophilus inf...
WP_013203207  79 DDFAWVAAILIGFIGIDYISFRFRKLTDKK 108 Erwinia billingiae
ACQ67609      80 ASAPQVLAIYIGYVGTDYIRARIQSFTQRK 109 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
WP_012738124  80 ASVPGVLAIYIRYVGTDYIWACIQSWTQRK 109 Candidatus Hamiltonella defensa
WP_024912602  72 LQWANIASVLIGFLGIDYLSDLIKKLINKK 101 Chania multitudinisentens
WP_004248367  71 HQFAYLASVFIGYVGIEPVSKLLIR----K 96  Proteus
CBJ80334      71 PDLAYIGSVVIGYLGTDFIGQLLRKAAEKR 100 Xenorhabdus bovienii SS-2004
P03705        69 SNLAYITSVFIGYIGTDSIGSLIKRFAAKK 98  Escherichia virus Lambda
Q7N0Y0        74 TDLAYISSVIIGYLGTDYFGQILRKVVNNK 103 Photorhabdus laumondii subsp. laumondii
ACQ68282      65 TDYTWLISIVIGYLGTDYIGSWLKK---KL 91  Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
P44188        76 TEYSSFLGTMIGFVGTEKIREFLFKFINRR 105 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap