Conserved Protein Domain Family
DivIVA

?
pfam05103: DivIVA 
DivIVA protein
The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils.
Statistics
?
PSSM-Id: 398666
Aligned: 55 rows
Threshold Bit Score: 72.616
Threshold Setting Gi: 122272032
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
bgi:05SSU0487   3 LTALELKDKTFATKFR-GYDADEVDDFLDIVTRDYEDLIRKNHDQELELKNLRERLAYFDEMKESLSKSVLLAQDTAEKV 81  Streptococcus ...
Q5FJX9          9 LSAQDILKKQFRSKVK-GYDPDEVDAYLDQVISDYETFQQIVEDLYGQIGTLQRQLMDEKQKENK-----VSNSSEDEHV 82  Lactobacillus ...
WP_012063921    2 LTPLDIQNKEFKKGMR-GYKEDQVDEFLDELMVDYEKLYKENSELKDETEKAHTQLEQYKNIEETLKNTLVVAQSTAEQV 80  Alkaliphilus m...
jgi:Ccel_0600   3 YTPNDLDNIKFKKNFM-GYNEDQVNEVLDSVIQDYELYIKENIELKDRISVLNEGIQHYKNIEESLQNTLIVAQQTGEEI 81  Ruminiclostrid...
WP_003516367    3 YTPNDLENLTFKRSVVgGYSEDMVNEVLDKIIEDYVAYIRENIELKDKVAMLNEAIAHYKNIEESLQNTLLMAQQTSEEI 82  Hungateiclostr...
jgi:Ccel_3443   3 YTPEDFKCLCIKKSLVnGYCRKQVDAILAQVGEDYISMAKESEEIKNKIDILNETVQHYKILEESLQHSIIVAQHTSEQI 82  Ruminiclostrid...
CDC04823        4 LTLEDIANISFPRANFgGYRAEDVDAFIDDVQVSYDNVLKESAELKRKLAILAQKVEEYRNEEDSIRNTLLSAQKLADAS 83  Clostridium le...
WP_012200374    2 ITPIEIQSKTFKSGGL-GYDKKDVDSFLREVLLSYEQIYRENMEMKDKISVLTEGIQYYKTIEKTLQKALVLAEKTAEDT 80  Lachnoclostrid...
WP_012635869    3 LSPLDIYNKEFKKTTF-GYSQAQVDEFLDEVGRAYERVLKEVNHLKDENEKLRERLGNYENLEQDLKNMMAAIEETAKEK 81  Halothermothri...
Q0AYD1          2 ITAMEIRNQQFPKSLR-GFNQDEVKKYLLNLAQDYESLYSENASLKEKIQNLEYELSKYRKLEETMNNSLILAQQTAEDL 80  Syntrophomonas...
bgi:05SSU0487  82 KVAAEDQAANIIKQADYDAATLLHeakdkaneilrNATDNAKKVVIETEELKNQTRIFHQRLK 144 Streptococcus suis 05ZYH33
Q5FJX9         83 KTYTPTHRRTSSVASFAEDDNNQ------------------GEISTNMAIIQRISTLERKVYN 127 Lactobacillus acidophilus
WP_012063921   81 RQSGQKSAQIMIQEAENKGKELLY-----------QANKQVDVVSKEYEDMKRQVQIFKNRYK 132 Alkaliphilus metalliredigens
jgi:Ccel_0600  82 KKNSYEKAENIIKEAELKAQRVIN-----------DANQEVIKIRFEYEEMKKRLHLFKTKSE 133 Ruminiclostridium cellulolyticu...
WP_003516367   83 KRNSYQKAENIIKEAEIKAQKMID-----------EANQEVLKIKFEYEELKRKLHSYKSKVE 134 Hungateiclostridium thermocellum
jgi:Ccel_3443  83 KTNACEKAKNITDEAEISAKKIIE-----------TANLEVIKAKGKLDEIKGQLYSFKTKSE 134 Ruminiclostridium cellulolyticu...
CDC04823       84 VREAKHKAEVIVADATEKAERIIL-----------GAQKEADSQKGELGRLKEEVAAFRTKLl 135 Clostridium leptum CAG:27
WP_012200374   81 KAQALVTAKNIENEAMTRAQIIVA-----------DAKNELEHLHAQTIGLLQQYEKYKLQFK 132 Lachnoclostridium phytofermentans
WP_012635869   82 TKQAQKEAEMIINRARVKADNIVK-----------DVKEQIQEEYRTLQELKESRDLFKIRFK 133 Halothermothrix orenii
Q0AYD1         81 KSSARKEADLMLEESKKRI----------------------IEVMMVYQEIIKRMNIFNVELK 121 Syntrophomonas wolfei subsp. wo...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap