Conserved Protein Domain Family
Bac_GDH

?
pfam05088: Bac_GDH 
Bacterial NAD-glutamate dehydrogenase
This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.
Statistics
?
PSSM-Id: 398658
Aligned: 105 rows
Threshold Bit Score: 1751.6
Threshold Setting Gi: 500032400
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
mmlSJTU:SCATT_19950   84 VRVHTPTVEENGWTC-SHTVVEVVTDDMPFLVDSVTNELSRQD-RAIHVVIHPQVVVRRDVAgKLLEIlgtgnlveaahA 161  Strept...
jgi:Xaut_1432         79 vRIFNPELHGG-----PVTVIEAVNDDMAFLYTSLAGEIIECG-LELKLAAHPILHVERNAEgAVTGL-----------E 141  Xantho...
WP_012333450          84 V------VERDGGRR-DVTVLEAINPNRPFLLDSTLAELVARG-YEPRLVAHPILAVERGPDgALLRL-----------V 144  Methyl...
jgi:Mrad2831_0077     82 mrlsdreLVRDGHPR-ETTVLEVINDNRRFLLDSTLAELTEQG-LAPQLVAHPILGVERDGSgGLIRV-----------V 148  Methyl...
jgi:M446_3850         84 LRD--ATIERSAQPC-EITVIEVINDNRPYLLDSTLAALTEHG-LTPDFVAHPILGVERDAGgALVRV-----------V 148  Methyl...
WP_013176905          68 lRVYNPTLENDGWSV-PYTVLELSLGDRPFIVDSVRAELRRHN-VDVLHLLHPILEVHRDADgKLLGF-----------G 134  Truepe...
jgi:Hipma_0217        70 ddiklelEDIQIENK-NYTQIKLLTDNNPFIVDSITSIINNLNeFYIDFSIQPIFVIERAKSgKLTKI-----------E 137  Hippea...
WP_011713118          92 EEVTCIQ---------EGTRIYIHLHDTPFMLDTVRNYLKQSK-LTIYAQAHTTVHVKRSRTgEPVAL------------ 149  Magnet...
Q2GKF6               104 vRVFD--VARPNFPDeSLTIVETANDNLPFIVDSVMIAIKKHD-LPIYHYTNSVLHIKRD-DsRIVDVd---------iL 170  Anapla...
Q2GG64                69 VKIFNIEEQDNETIS-NVTIIEIINDNLPFIIDSIIIAIKKHN-ASIYHYTNAVLNIERK-EqHIHAI-----------S 134  Ehrlic...
mmlSJTU:SCATT_19950  162 GLPGAELPHDAl----iESWIHVEVDRETDRADLK-QITTDLRRVLNDVRESVEDWTKMRDAALRIADELA-ATPPP--L 233  Strept...
jgi:Xaut_1432        142 LPLRRGELSEEn----rESLIHIHVPAM--GEAERtQLKAVLARVLKDVGVVNDDFSAMRKQVRSLSKGYR-REKRP--Y 212  Xantho...
WP_012333450         145 GETTAGAGDALs----rESFIHIHLDRI-DDEGERaGLLDGLAQVYADVAVSTQDHRAMLARLDAVAAAYE-SAPPP--V 216  Methyl...
jgi:Mrad2831_0077    149 GETTADAQGSLa----rESFIHIHLDRL-AVETGE-RLLNALAAVYRDVALAGDDRDAMLARLTDLAADLG-RGPTP--M 219  Methyl...
jgi:M446_3850        149 GETTAEAHGGLa----rESLIHIHLDRI-EGAARE-RLEAELGEVYRDVALVSDDAEAMRVRLAALSAGIG-QGSPL--L 219  Methyl...
WP_013176905         135 EGGVPEA----------YELYFLALEPR---EAARrALAKAVENILQDVVLATDDYGPMRAQAKALSRYLAeLAQAErrI 201  Truepe...
jgi:Hipma_0217       138 FPHESGNK---------ELYLLFLLDAISDIQ--KdKLRKDIVNSVEEGRLAVSDFKDMEKRVKDIARKLN--DPIYlkK 204  Hippea...
WP_011713118         150 --------AQTdtkgylREMVILILSETVDDKHLE-QIRDELQAVLTSVKRSVDDFAAMQQQVLAQALLLDg-------- 212  Magnet...
Q2GKF6               171 PSDSCAENGTC------ESVAYFVVGKT--TKDLQeKLKADVEKALYSVTCCVNDWKPMLDRVSDLLHDFE--------- 233  Anapla...
Q2GG64               135 PAQSCLNDETS------ESIVYFIISNI-DKESHK-SLKHDIEKNLQLVGYCVNDWKSMLHHFDSALNVMK--------D 198  Ehrlic...
mmlSJTU:SCATT_19950  234 PE-QEVGEAWELLRWLADDHFTFLGYREYKLATEPGPDggpedVLVAVPGTGLGILRADPthrdhdgTHPVSGAFHRLPQ 312  Strept...
jgi:Xaut_1432        213 DA-DAQEEAADVLEWLTENNFVFLGLRHYELIADG--------SLRAEPNSGLGILRDPDv-----hELRLGNQPVVTTP 278  Xantho...
WP_012333450         217 AA-EEVAEARAFLDYIRADQFTFLGMREYRLGEGA--------EYRGVRESGLGLLRDGSv-----eVLRRGRTMVAMTP 282  Methyl...
jgi:Mrad2831_0077    220 PG-TETEEARAFLEWLTDGQFLILGMQEHGIAGD---------AHPLVEGSSLGVLRDPGa-----tPLRRGRTPVDYTP 284  Methyl...
jgi:M446_3850        220 SE-VETIEARAFLDWLADGHFTLLGMQEHGIAGE---------TYSLVPESSLGVLRDRGa-----aVLRPGPGWIDYTP 284  Methyl...
WP_013176905         202 ERaDELAEYAEFMRWLTQDNYVFLGYREYDLLEPETPGgd--lRLQVTPDSGLGVLRKVSs------AYNTPVPLSRLPE 273  Truepe...
jgi:Hipma_0217       205 ISeKDTEDIKEFLMWLLDENFIFLGMRTYRLDYEEDDI-----LIQMDKPSCLGILRKIEr-----sMFKDKISIKELPE 274  Hippea...
WP_011713118         213 ---EKLTEEASFFRWMADENFVFMGTRSIIASGEQ--------LVVDQAVPSFGVLRGHD----------STALLDRIMP 271  Magnet...
Q2GKF6               234 -KdLSCSEICHFLKWMSSDNFVFLGFEEYVKSPSSSE------DLVLLIERSLGLARIES------------------HR 288  Anapla...
Q2GG64               199 LYdNSIEEEITFLEWLRKDNFIFLGYEEYIVDQH---------KLLINTKANLGLQKTNT------------------SD 251  Ehrlic...
mmlSJTU:SCATT_19950  313 DARAKARE-HKLLILTKA-------------NSRATVHRPSYLDYVGVKMFDADGN---VTG----ERRFLGLFSSAAYT 371  Strept...
jgi:Xaut_1432        279 EICAFLES-PSPLLFTKA-------------SLRSLVHRRDMMDYVGIKAHDDDGR---VVG----EVRLIGLFTATAYT 337  Xantho...
WP_012333450         283 EIRAFLER-PEALIITKA-------------SLISRVHRRTHLDMVGIKLFSGDGR---VAG----ELRIVGLFASTTYT 341  Methyl...
jgi:Mrad2831_0077    285 EILAFLEE-PQPLIITKA-------------SVKSRVHRSAYLDYVGVKLFSGLGK---LSG----EVRIVGLFTASAYT 343  Methyl...
jgi:M446_3850        285 EILTFLQE-PQALIITKA-------------SAKARVHRAGYLDYIGIKLFSADGK---LSG----EVRVVGLFTASAYA 343  Methyl...
WP_013176905         274 GLRERVVG-GQVLTVTKT-------------NAEATVHRPARMDYIGIKKV--------VRGvfrgEHRFVGLFTSKALS 331  Truepe...
jgi:Hipma_0217       275 SALDTVKA-GNVLVIDKT-------------NSKSNVYDTRRMDYIAISEFDKDLK---VIK----RHIILGLFTSKALK 333  Hippea...
WP_011713118         272 GMRQEIEKiLNLLVKRHGqdphpklaieyceHGRSIIYAAEGVDFVVLLRPANPNQatlVLT------LILGRFSRTGLA 345  Magnet...
Q2GKF6               289 ESTKGSAYgRVHLYVAQS-------------NLVSNVHRHEYMMCVGIKTFNTSGDvidVIK----ESCFYGFFTSAVAF 351  Anapla...
Q2GG64               252 ESSKNLSNsTEHVYIIQS-------------NILSTVHRHEYMICVGLRIFNQDNI---LVK----EHCFYGFFASIISF 311  Ehrlic...
mmlSJTU:SCATT_19950  372 ESVTRVPVIRRKVQEVLSGAGFSPDSHDGRDLLQILETYPRDELFQTGADELRPIVTSVLYLQERRRLRLFLRQDEYRRY 451  Strept...
jgi:Xaut_1432        338 QPVREIPYLRLKAASVVKETGLEPGSHSAHALQTLLETYPRDDLFQISTETLLVHAREILSLYDRPRLKVMARADRFDRF 417  Xantho...
WP_012333450         342 SRAEEVPYLRRKVATVVAEAGLDPTSHAGRSLLHVLETYPRDDLFQIDTDLLRRFALAIVLLAERPRVRVLARADKFGRF 421  Methyl...
jgi:Mrad2831_0077    344 SPAREVPVLRRKVEAVVDRAGLDPTSHAGRSLLAVLEGYPRDELFQIDSERLYRFTLAIAALADRPRVRVLSRPDRFGRF 423  Methyl...
jgi:M446_3850        344 NPAHEVPILRRKAAAAADRAGLDPTSHAGRSLLAVLETYPRDELFQIDLDRLTHFTLAIASLADRPRLRVLSRPDQFGRF 423  Methyl...
WP_013176905         332 TPVDEIPILRRKLRLVLALDHAKPGSHDFKRIISVFNSIPRDELFWSDPERLHRDIRTVMAMADEGGVRLTVRPDPLARG 411  Truepe...
jgi:Hipma_0217       334 EQASNIPFLKSKLDRILFEENVVEDSFEYKHMIDIFNTLTKDDLFISSTENLKILLEELLTCETEKRIKILTRQANLVHG 413  Hippea...
WP_011713118         346 SRASNVPILSRRLEKTLQLSGFTEGSYLHHEFRSLYDRMPLRELLYSNSPVITEQIKEILLMEGDNDVRVLARLGHYGNY 425  Magnet...
Q2GKF6               352 QSVLDIPIIRRKVEYAEARSGFMRYGHNGKALFTIIQKFSREELLRASEEELFQISMGILSLSGNPKVKLFTLRDTVNGF 431  Anapla...
Q2GG64               312 QDANSIPLIRSKIKAVEKRAGFTKGGHSNKALIDILQRLSRDELFQFSEEELFEISIGILSLANNPKIKLFIIKGQSHSF 391  Ehrlic...
mmlSJTU:SCATT_19950  452 YSALIYLPRDRYTTAVRLRLTEILMEELGG-STVDFTAWNTE-SVLSRLHFVVRVPTGATt-PEltdAEIDRIETRLVEA 528  Strept...
jgi:Xaut_1432        418 VSVLVFLPRERFDAEVRDKTGAILARAFEG-RVASVDQDFVTgIPLIRVHYIIDRSGGRI--PE---VDRGALERQVANA 491  Xantho...
WP_012333450         422 VSLLVFVPKDRTDAALQKRIAAHLAMRLGG-HISAIYPDYPE-GPLARFHIVIGRREEVP--PA---IDPAELEAEVTAL 494  Methyl...
jgi:Mrad2831_0077    424 VSLLVYVPKDRYDSAVRGRIGSYLAETYGG-RLSAAYPDYPE-GSLARIHYIIGLPDQGS--PE---HDPASLEAGIVAL 496  Methyl...
jgi:M446_3850        424 VSLLVYVPKDRYDSTVRARIGAHLAETYGG-HLSAAYPDFPE-GPLARTHYIIGLSEPGV--PE---RDPSALEAEIAGI 496  Methyl...
WP_013176905         412 FAVMVVMPRDRFNAEVRRAIQAYLTNAFRA-THVDYQLAIGEdEAQVRFHFFFTTDLDPH--T----LELSVLERRVAEL 484  Truepe...
jgi:Hipma_0217       414 VYLIAVLPVKFYSQKNIENFTQFLSETLKT-EDIEYKIITQS-PRIIRIHYYLIFDKYKK--PK---IDVEVVEENLKEI 486  Hippea...
WP_011713118         426 VAVLTTLARSRYHPRLQTQIAELYSKQLDF-PISSIN----S-TDNGTVHTVVCYANHEPdkPFg--FNRTAIEAQVRRL 497  Magnet...
Q2GKF6               432 IVCIIFIPKSVASTELADRIALVLEGTLMGeVVGKYYNMYNE-SDLVRLQFTVKVAADAE--CL---LSERDIEKLVVET 505  Anapla...
Q2GG64               392 VNCIIFIPKALASTELANKMSYILEQMLTGkVVNNQYNMLNE-YNLVRLQFILKAQDKLF--SD---FSELEIEEKLIAA 465  Ehrlic...
mmlSJTU:SCATT_19950  529 ARSWDDGFADALGAECGEE--RAAELSRRYAHAFPEGYKADFPPRTAVADLTHIERLRPEDDFTLSLYEP--V------- 597  Strept...
jgi:Xaut_1432        492 MLSWGDRLGFAISALPGIDweMAALLKHRYAFAFGPDYEAAYDVATALADIDRLERLTPARPVALDFYRR--P------- 562  Xantho...
WP_012333450         495 SRTWADGLRDALAEAMDGG--RARALGAYYAEAFPAGYRETYDSAQALSDIAILERITAERPRAVDLHRH--P------- 563  Methyl...
jgi:Mrad2831_0077    497 VRTWGDALRAALAESQGGD--RARRLAARYGDAFSAAYRDDFQPESAVADVLVLDGLGETQPRAVHLDRR--P------- 565  Methyl...
jgi:M446_3850        497 VRTWGDSLRAALATLSDGA--RARMLAARYAEAFSVAYRDNYLPEVAVADVAILERLKADRPRGVDIGRR--D------- 565  Methyl...
WP_013176905         485 TRTWDDHLGELLEATYGPA--RGRHLAARYARFFDERYRADTRPETAVHDVAAFEEL-EHTPFVVRFRNPegPdraqgga 561  Truepe...
jgi:Hipma_0217       487 VSSWKDNFRSALADMYGSG--KASYYINKYMNSFDDEYISKTSPDEAIFDIEHFEKILTSQEVEADIYTQ---------- 554  Hippea...
WP_011713118         498 VMTWEDHLREELLTKYAPR--LAFQLCTRYSSTFNILYKEATPADQAVLDIEMLEKLVEGSSFTSRIAHY--P------- 566  Magnet...
Q2GKF6               506 TKRWEDRLAEVIMEKMGSK-------FLEYVTAFPKGYQEYFAPRSACHDILKIHKVLESGIGEVDLYLL---------- 568  Anapla...
Q2GG64               466 SRRWEDKLQDVMCCNLGSI-----NPFLQYLTAFPPSYQEYFNPKSAYHDIIKLEQVCKYNTSEADLYLI---------- 530  Ehrlic...
mmlSJTU:SCATT_19950  598 ----AASPGERRFKIYR-TGAPVSLTAVLPVLQHLGVEVVDERPYELKRADS---SRAWIYDFGLRIDRS----AGDlGD 665  Strept...
jgi:Xaut_1432        563 ----GDDERRISLRLLS-FGAPLPLSTRVPMLESMGLRAINERSYRIEPTGEa--ARSWLHDMTLERADGg---SIS-MA 631  Xantho...
WP_012333450         564 ----GDPETRIGLKVFS-KGSALPLSDRVPVLENFGFRVIDERTFLIGRPGApetDGIWLHDMLLERAGGg---AID-LA 634  Methyl...
jgi:Mrad2831_0077    566 ----SDAAAQVRLKAFS-RGTAIALSDRVPALENLGFRVLNERTYQIAPSGTeeaAQVWLHDMLIERATGa---PIH-LA 636  Methyl...
jgi:M446_3850        566 ----TDPANQIRLKAFS-RGTSIALSDRVPALENLGFRVINERTYQVRPSGVgegDRVWLYDMLLERATGa---DIS-LA 636  Methyl...
WP_013176905         562 epapDGAPNDTHLEVYH-RERTLVLSEVLPILENLGFRVLEQVSYFVSLAE----GPVPVRGLDVFRVQGaqgeRLE-LA 635  Truepe...
jgi:Hipma_0217       555 -------GDSIFFNIY--SLNKLPLYEILPKLNNMGLNVLYEDFVSIEINK----KIVYIQRFSVDPAKLd---LTN-AD 617  Hippea...
WP_011713118         567 -------KGQVYIKLY--AHKPAMLTKIVQTFDNFGISCLHEFSTEVMLEAN---KPLTIQRFEVGGSSAqisaLLN--- 631  Magnet...
Q2GKF6               569 -----DNDSQYQLKIYVpLESDLRLSKVLNVVKKMGAKMSLHYGYDVNVHG----QCMRLHHFVLSNTHR----SLD-HH 634  Anapla...
Q2GG64               531 -----KNSVHYQLKIYIpQESNLQLSKILSIVKKMGTNIILHHSYTITAK-----ITVYLHHFILSNTKQ----SFD-HN 595  Ehrlic...
mmlSJTU:SCATT_19950  666 DAR-ERFQDTFAAVWTGQAENDGFNSLVLRAGLTWRQAMVLRAYAKYLRQAGATFSQDYMEDTLRTNVHTTRLLVNLFEA 744  Strept...
jgi:Xaut_1432        632 GAD-ERLEDCLNAVLRGAAANDGYNALVLDAALSFREVALVRALGHYIRQAGIPFSQDYIWQTLNAHGALARSIMALFHA 710  Xantho...
WP_012333450         635 RLD-RPVEAALLAIARGLAETDAYNRLILEAGLGWRDAALLRALGRYLRQLRIRYGQGYLAATLSRHPALAAGIVALFYA 713  Methyl...
jgi:Mrad2831_0077    637 ALE-RPLEAAMLAIADGIAESDGYNRLVLEAALPWREAALLRALGRYLRQLRIRYGQDYLAGTLSRHAGIARAIVALFRA 715  Methyl...
jgi:M446_3850        637 EA--AVLEEAMLAVADGLAESDGYNRLVLEAALPWREAALLRALGRYLRQLRIRYGQDYIAGTLARHPVIAKGLVALFRA 714  Methyl...
WP_013176905         636 AVG-ERLQEALVALLRGQAENDRLNRLVLYGGLRVRQVALLRTLQALYAQLSAGTSRRFVNDTLLKHPALAGLIYRAFEA 714  Truepe...
jgi:Hipma_0217       618 KLF-KTINENFEAIWRGIVEDDGLNELTTKAVMGYKYIDVLRTLSNYLMQINFQIKKASIISVLVKYPHLASMLIDYFEN 696  Hippea...
WP_011713118         632 --RaELFCEALNAVQEDAILDDKLNKLVLIQGFHPKEVMLMEALRQYLLQIRPELSTKKLNRVLLEHHPLTKRILNLFIA 709  Magnet...
Q2GKF6               635 RVK-SQFETVLKQVFCKKTENDYFNSLVILANLQWKEVLLIRALSRYLKQISFNYSQSYIQKVVRKYPDMINLFVKLFEA 713  Anapla...
Q2GG64               596 SIK-QQFETTIKKIFAKEIENDYFNSLVILANLHWKEVMLIRALSRYLKQVSFNYSQIYTQKVAIKYPKVLFNFIKLFEA 674  Ehrlic...
mmlSJTU:SCATT_19950  745 RLSPEHRRAGSELT-------DGLLEELDGALDQVASLDEDRILRSFLTLIKATLRTNYFQRDAEGRPHPYVSMKFDPQA 817  Strept...
jgi:Xaut_1432        711 RFDPTLDPSAEARAar----eAPLRAAIDDELAEVSSLDQDRILRRFVNLVDAAIRTTFYQSDDEGRPKEAIAIKFESAK 786  Xantho...
WP_012333450         714 RFDPRAEGGAESRAar----eAALRAEIEAGLSAVTSLDEDRILRRFVNLVEAAQRTNFFQVAPHGLPPDTIAFKFRCAK 789  Methyl...
jgi:Mrad2831_0077    716 RFDPAL---AGDRTaq----eAEVRAGIETALAGVTSLDDDRILRRFVNLVEAAVRTNFYQTGADGQPRETISFKFVCAK 788  Methyl...
jgi:M446_3850        715 RFDPAA---TGDRVaa----eAVARAEIEAALSGVTSLDEDRILRRFVNLVEAALRTDFFQVAEEGGPRDTISFKFACAK 787  Methyl...
WP_013176905         715 KFAPDPPGGPARGReareaalAEVRADFNEGLAEVASLAEDGTLQGLFNLVEAAVRTNFFLD------KPFISLKLESAR 788  Truepe...
jgi:Hipma_0217       697 KFSPQLASEEEV---------KKVYEKTKNELEQINDIHEYRIVHSLFNIIESTVRTNFYKR--NKK-YHYISLKINSSK 764  Hippea...
WP_011713118         710 RFDPVGERGRKKRI-------KEILDGLEEGLQGVANLQDDQVIRALTNVVTSALRTNFYQQ--RG--CHGISFKVDCSA 778  Magnet...
Q2GKF6               714 RFDPKLSEGREEKV-------ASVRKSIEDLFAQVSDVVHDYVLKSMYMLIMAILRTSYYQD--D---KPYLSIKIDSCA 781  Anapla...
Q2GG64               675 RFNPEMANDQES---------HAIENKINELLLEVTDVVHDHILRSIYALILAILRTNYYKD------KDYLSIKLDSSK 739  Ehrlic...
mmlSJTU:SCATT_19950  818 IPELPAPRPAYEIWVYSPRVEGVHLRFGKVARGGLRWSDRREDFRTEVLGLVKAQMVKNTVIVPVGAKGGFVGKRLPdp- 896  Strept...
jgi:Xaut_1432        787 VEGLVLPRPLYEVFVYSPRVEGVHLRFGKVARGGLRWSDRPQDFRTEVLGLVKAQQVKNAVIVPVGAKGGFVPKRLPa-- 864  Xantho...
WP_012333450         790 VDGMPLPRPLFEIFVYSPRVEGVHLRFAYIARGGLRWSDRPEDFRTEILGLVKAQQVKNAVIVPVGAKGGFFPKRLPp-- 867  Methyl...
jgi:Mrad2831_0077    789 VTAMPLPRPFFEIFVYAPRVEGVHLRFGYVARGGLRWSDRPEDFRTEILGLVKAQQVKNAVIVPVGAKGGFFPKRLPp-- 866  Methyl...
jgi:M446_3850        788 VVGMPLPRPLFEIFVYSPRVEGVHLRFGYVARGGLRWSDRPEDFRTEVLGLVKAQQVKNAVIVPVGAKGGFFPKRLPp-- 865  Methyl...
WP_013176905         789 VTHMPEPRPLYEIFVSAPTVEGVHLRGGRVARGGLRWSDRPDDVRTEVLGLMKTQMTKNAVIVPVGSKGGFVLKGEP--- 865  Truepe...
jgi:Hipma_0217       765 ILTMPSPRPMFEVYVHSSFMEGCHLRGGKVARGGIRWSDRKDDFRLEILGLMKTQMVKNAVIVPVGSKGGFIVKAVA--- 841  Hippea...
WP_011713118         779 IDQMPSPRPWREIFVLSPHMEGVHLRGGRVARGGLRFSDRLEDFRTEILGLMKTQMVKNSIIVPIGAKGGFIVPRIAdip 858  Magnet...
Q2GKF6               782 VPDMPLPRPFREIYVYSNEFEGIHLRGGRVARGGLRWSDRSEDFRTEILGLMKAQMTKNSVIVPVGSKGGFILKGDS--- 858  Anapla...
Q2GG64               740 VPNIPLPCPFREIYVYSNLFEGIHLRGGKVARGGIRWSDRTEDFRTEILGLMKAQMTKNSVIVPVGSKGGFILKRAP--- 816  Ehrlic...
mmlSJTU:SCATT_19950  897 aADRDAWLAEGIACYKTFISGLLDITDNL-VGGDVVPPKDVVRHDG-DDTYLVVAADKGTASFSDIANEVAES-YGFWLG 973  Strept...
jgi:Xaut_1432        865 gGSREAVMAEGTAAYEIFVSSLLDLTDNL-KGGQVVHPADTVRLDG-DDPYLVVAADKGTATFSDTANAISAR-HGFWLD 941  Xantho...
WP_012333450         868 aSDRQAWMAEGTESYRIFIRTLLSLTDNI-VDGAIVPPADTVRHDG-DDAYLVVAADKGTATFSDIANAISIE-RGHWLG 944  Methyl...
jgi:Mrad2831_0077    867 aSDRAAWMQEGTESYRIFIRTLLELTDNI-VDNAIVPPPGTVRHDP-DDAYLVVAADKGTATFSDIANALSLE-KGHWLG 943  Methyl...
jgi:M446_3850        866 aSDRQAWMAEGTESYRIFIRTLLSLTDNI-VDGAIAPPKDTVRHDPaDDAYLVVAADKGTATFSDVANAISLE-RGHWLG 943  Methyl...
WP_013176905         866 -SDPEALRPFVREAYQTYLRGLLDLTDNL-VEGRVVHPEGVVVFDD-PDPYLVVAADKGTATFSDLANQTAAE-YGFWLG 941  Truepe...
jgi:Hipma_0217       842 -KNREEWIELGKKAYRTLMRGMLDVTDNIdENNNEIRPEDVVCYDE-FDPYLVVAADKGTATFSDIANEISEKeYNFWLK 919  Hippea...
WP_011713118         859 aNQRKEWVENQ---YKTLIRGLLDITDNR-VEGELVYPEQVVRYDE-ADPYLVVAADKGTATFSDIANGVAEQeYHFWLG 933  Magnet...
Q2GKF6               859 --KKVSSVEYAVECYKNFLRGILDITDNI-VDGQCVTADGIVRYDD-DDSYLVVAADKGTASFSDYANEVSAE-YNFWLG 933  Anapla...
Q2GG64               817 -KNAALLKSTAVECYKNFLRGILDITDNI-IDDKYVTPNDIIKYDE-YDPYLVVAADKGTATFSDYANEISEE-YNFWLG 892  Ehrlic...
mmlSJTU:SCATT_19950  974 DAFASGGSVGYDHKKMGITAKGAWESVKRHFREMGHDTQSEEFTVVGIGDMSGDVFGNGMLLSEHIRLVAAFDHRHIFLD 1053 Strept...
jgi:Xaut_1432        942 DAFASGGSVGYDHKAMGITARGAWEAVKRHFREMDIDIQVTPVTVAGVGDMSGDVFGNGMLLSRALKLVAAFDHRHIFID 1021 Xantho...
WP_012333450         945 DAFASGGSQGYDHKAMGITARGAWEAVKRHFREIDVDVQSQPVTVVGVGDMSGDVFGNGMLLSRCLKLVAAFDHRDIFLD 1024 Methyl...
jgi:Mrad2831_0077    944 DAFASGGSQGYDHKGMGITARGAWEAVRRHFREIDVDVQTDPIVTVGVGDMSGDVFGNGMLLSASLRLIAAFDHRDIFLD 1023 Methyl...
jgi:M446_3850        944 DAFASGGSQGYDHKGMGITARGAWEAVKRHFREMDVDTQSDPFTVVGVGDMSGDVFGNGMLLSPTLRLLAAFDHRDIFLD 1023 Methyl...
WP_013176905         942 DAFASGGSYGYDHKKEGITARGAWECVARHFRELGLDVHRDTFTAFGIGDMSGDVFGNGMLYTPKLKLLAAFNHQHIFLD 1021 Truepe...
jgi:Hipma_0217       920 DAFASGGKHGYDHKKIGITARGAWQCVERHFREMGKNVFTDTFTVVGIGDMSGDVFGNGMLYTDKIILKAAFNHIEIFID 999  Hippea...
WP_011713118         934 DAFASGGSYGYDHKKVGITARGAWTCIRQHFAELGHDIDSQPFTVVGIGDMSGDVFGNGLLASRQIKMVGAFNHLHIFLD 1013 Magnet...
Q2GKF6               934 DAFASGGSVGFDHKKIGITAKGAWVAAQRHFWVMGRDIQRSTFTVIGIGDMSGDVFGNGMLMSDKICLLGAFNHKHIFVD 1013 Anapla...
Q2GG64               893 DAFASGGSIGFDHKKMGITAKGAWVGAQRHFWLMDKDIYNEPFTVIGIGDMSGDVFGNGMLLSNKIHLIGAFNHNHIFID 972  Ehrlic...
mmlSJTU:SCATT_19950 1054 PDPDAAASYAERRRMFELPRSSWADYDTSLISAGGGVHPRSAKSITITPQVRKALGIEGRAtkMTPAELMKAILKAPVDL 1133 Strept...
jgi:Xaut_1432       1022 PNPDPASSFAERQRLFNLPRSSWADYDASLISKGGGVFPRSAKSIDLSDEVRALLRFPKAH--ATPAELITAILKAQVDL 1099 Xantho...
WP_012333450        1025 PDPDPATSYAERRRLFELPRSSWADYDRDKISAGGGVFPRSAKTVPLSPVIRARLGFDRAE--ATPAEVMQAILKAPVDL 1102 Methyl...
jgi:Mrad2831_0077   1024 PNPDAARSFAERRRLFDLGRSSWADYDRSLISDGGGVFSRSLKTVPLSDAIRSALGFDRSE--ATPTELMQAILKAPADL 1101 Methyl...
jgi:M446_3850       1024 PNPDAARSFAERKRLFDLGRSSWVDYDRSLISAGGGVFSRLLKTIPLSPEAQAALHFDRSE--VTPAELMQAILKAPADL 1101 Methyl...
WP_013176905        1022 PDPDPEASYRERRRLFELPRSTWADYDPAVISAGGGVYSRFAKSIPLSEPVRRVLDLEAEA--LSGQDLIRAILKMPVDL 1099 Truepe...
jgi:Hipma_0217      1000 PNPDPEASYKERKRLFD-NGLTWKYYDKKLLSKGGFVVDRNAKSIKLTKEAKEFLQTNKNE--VSGEDLIKLILQADVDL 1076 Hippea...
WP_011713118        1014 PDPDPASSFEERQRLFNLGRSGWNDYNGALISTGGGIFNRSAKAIPLNDTLRNLLDTKSET--LSGEQVIQKLLLAKVDL 1091 Magnet...
Q2GKF6              1014 PTPDPERSFVERKRLFNTPGSSWQDYDAALISKGGGVFCRSSKSISLTKEMRQCFGIEDREssISPNCLIKHMLKAPVDM 1093 Anapla...
Q2GG64               973 PSPDPEKSFLERKRLFNLTSSSWEDYDKSCISKGGKIFNRNSKILDLTPEIKELFNISEDQ--IFPNELIKHLLKAEVDM 1050 Ehrlic...
mmlSJTU:SCATT_19950 1134 LWNGGIGTYVKASTESHADVGDKANDAIRVDGSELRVKVVGEGGNLGLTQLGRIEFARsggpdgTGGRINTDAIDNSAGV 1213 Strept...
jgi:Xaut_1432       1100 LFFGGIGTYVRASTETDAQVGDRANDAVRIAASDLGAKVVGEGANLGMTQRSRIEAAR------RGVKLNTDAIDNSAGV 1173 Xantho...
WP_012333450        1103 LWFGGIGTYIRASGESDDEAGDRANDALRITGAEVRARVIGEGANLGVTQRGRIEAAR------RGIRLNTDAIDNSAGV 1176 Methyl...
jgi:Mrad2831_0077   1102 LWFGGIGTYVRATTETDEDAGDRANDALRITGPELRAKVVGEGANLGLTQRGRIEAAR------AGVRLNTDAIDNSAGV 1175 Methyl...
jgi:M446_3850       1102 LWFGGIGTYVRSTSETDDEAGDRANDAIRVTGTDLRARVVGEGANLGLTQRGRIEAAR------RGVRLNTDAIDNSAGV 1175 Methyl...
WP_013176905        1100 FWNGGVGTYVKASTETHAEAGDSANNAVRVDACELRARVVGEGGNLGFTQRARIEYAL------AGGRINTDAVDNSAGV 1173 Truepe...
jgi:Hipma_0217      1077 LWNGGIGTYVKATDETNEDVGDRLNDAVRIDASQLRAKIVGEGGNLGLTQKARIEYAL------RGGKLNTDALDNSAGV 1150 Hippea...
WP_011713118        1092 IYNGGIGTYVKSRYETHLDVSDKANDSVRVDAHQMRCRIIGEGGNLGVTQKGRLEFAM------NKGRINTDAVDNSGGV 1165 Magnet...
Q2GKF6              1094 IWNGGIGTYVKSSKENNAVVGDKANDSLRIDGKEVRASMIVEGGNLGCTQLGRVEYAE------AGGQINTDFVDNSGGV 1167 Anapla...
Q2GG64              1051 IWNGGIGTYIKSSQESNAVVADKTNDALRINGSEVKAAMIIEGGNLGCTQLGRVEYAH------NGGKINTDFTDNSGGV 1124 Ehrlic...
mmlSJTU:SCATT_19950 1214 DASDHEVNIKILLNSVVADGDL-TVKQRNTLLAEMTDEVGALVL-RNNYAQNVALANSMAEAHSLLPAQQRYIRRMVREG 1291 Strept...
jgi:Xaut_1432       1174 NTSDVEVNIKIALALPLERGDL-TTPDRAALLKQMTDEVGALVL-RNNYLQTLALSLAENKGADDLAFQQRLMQMLEARG 1251 Xantho...
WP_012333450        1177 NTSDVEVNIKIALTTPERDGRL-GPEARNALLAGMTGQVADLVL-RNNQIQTLALSLAQRQGAAESGFATRLMQALEAEG 1254 Methyl...
jgi:Mrad2831_0077   1176 NTSDVEVNIKIALMTPERDGRL-SYEARNALLADMTDEVGRLVL-RNNELQTLALSLAQRGGLGETGFAMRTMQALEAEG 1253 Methyl...
jgi:M446_3850       1176 NTSDVEVNIKIALMGPERDGRL-TDKSRNALLADMTEEVSRLVL-RNNELQTLALSLALHGGVGETGFAMRTMQALEAEG 1253 Methyl...
WP_013176905        1174 DMSDHEVNLKILLQPLVTAGRL-SFDERNALLKEMTAEVSALVL-RDNYRQSLALSLAQRRASRDVSPFVSLQAYLAERG 1251 Truepe...
jgi:Hipma_0217      1151 DMSDHEVNLKILLGQLMKDGVLkDLEARNKMLEDLTEEVTQRVL-THNYMQSFAVSLDEMRSKQEPDIFFELDNFLKNKG 1229 Hippea...
WP_011713118        1166 DLSDHEVNLKILFAHLEQIGELpSRQARNELLAHLTEQVAEKVL-EDNHLQHMAMSRDELLSGQSPEIYLEGLDILEEVA 1244 Magnet...
Q2GKF6              1168 ICSDFEVNLKICMEMAVKDNFI-SLDERNKILDEMLHDVLGIILtRHNTLETRALMLECMQAPKRVEQHHRIMQYLEKIG 1246 Anapla...
Q2GG64              1125 ICSDFEINIKICLRLAMQNKYI-SLAERNKILDDIMHEVPSIVLeSHNKLETKALMLECIQAKNRIEQHHRLLKYLEKIQ 1203 Ehrlic...
mmlSJTU:SCATT_19950 1292 KLDRALEFLPADRQIRERLGAGQGLTQPETSVLLAYTKITAAEEVLATEL------PDDPYLRGLLHAYFPHALREKFET 1365 Strept...
jgi:Xaut_1432       1252 ELDRAVEFLPSDAEIADRRSRGEHLTRPELAVLLAYAKLALDQDLVASNV------PDDAYLSGELVNYFPREIKERYPH 1325 Xantho...
WP_012333450        1255 RLDRSVEFLPSDAALAERAQADEGLTRPELAVLLAYAKLSLKDALLDSAV------PDDPYLSRELDRYFPPVLLARYPD 1328 Methyl...
jgi:Mrad2831_0077   1254 RLDRAVEFLPDDGTLAERMRRNEGLTRPEYAVLLAYAKLSLHDAILESAV------PNDPYFDRELQRYFPKALRDRFPD 1327 Methyl...
jgi:M446_3850       1254 RLDRAVEFLPDDAALAERMRRGEGLTRPEYAVLLAYAKLWLHDAIFDSTV------PNDLYFDRELQRYFPKALRERFPH 1327 Methyl...
WP_013176905        1252 TLRPDVEALPDAKTALAR-----GVTRPELAVLLAYTKMGLYRRLLETDF------PDEPFFAHYLVEYFPEALQARFRD 1320 Truepe...
jgi:Hipma_0217      1230 VLHKEDYPFPDRKELSLRVSRGVGYTRPELSVMLALNKMFVYNELLKSQV------FSGDTIDQYAIMYFPPTIRAKYQD 1303 Hippea...
WP_011713118        1245 GLDADEEDVPQREQLVEYL-ENHPMPRPLLAIMLGYTKLFAYRELLKSDV------VDLFFFERYLVDYFPDLVARDYAQ 1317 Magnet...
Q2GKF6              1247 MLDRAIEFMPSDEEIQKMISESKGFSTPQIAVLIAYTRMFIKGEIIKSGLllr-sgLEHVYESRYLLTYFPESMRDRFAQ 1325 Anapla...
Q2GG64              1204 VLNRDIEFLPSDEEITKMSAEMKGFTCPQIAILIAYTRTFIKNEIMLSNIfhhssnLSSLYESQYLLSYFPQYIRDNFAQ 1283 Ehrlic...
mmlSJTU:SCATT_19950 1366 QVDGHALRREIITTVLVNDTVNSGGTTFLHRLREETGASTEEI------VRAHTAARAIFGLGRIWDEVEALDnVVDAAV 1439 Strept...
jgi:Xaut_1432       1326 AIETHRLHREIIATGLSNAIVNQGGPSCLARIADQTGADAPAI------ARAFAAVRDSYHVPELNAAIDALDtKVLGAV 1399 Xantho...
WP_012333450        1329 AVASHRLRREIIATGLANAIINRGGPTLVSRLSDETGAEAPTV------AAAYAVTRDAFGLLDLNRAVDGLDgAVSGAQ 1402 Methyl...
jgi:Mrad2831_0077   1328 AVKGHRLRREIIATALANIIVNRGGPSLVTRLVDGTGADAATI------AKAYAVTRDAFGLMELNLAIDGLAgRVSGTG 1401 Methyl...
jgi:M446_3850       1328 EVKGHRLRREIIATALANIIVNRGGPSLVTRLVDSTGADAAAI------AKAYAVTRDAFGLMELNLAIDGLGgRIGGQA 1401 Methyl...
WP_013176905        1321 DILAHPLRREITATQFTNTVVDLLGMSFVHRNVRDTGASPVEV------VRGALLALEILEAPALLERLFALDgAVAADA 1394 Truepe...
jgi:Hipma_0217      1304 YIVKHRLKNEIAFTFMVNLIINNNGATSLLKIHMMTDQHIPQI------MKSMIFSYDVLDILNLRNELFEYEnKIPQQE 1377 Hippea...
WP_011713118        1318 ELTKHFLKREVIATSVTNRVVNQTGVGPLLATYNKVRRSRLDVpplpilFKAYVIAENMVDAPAFRAQVHGLGgRLSASV 1397 Magnet...
Q2GKF6              1326 YIRKHKLKHEILATCISNDIVNRMGCVFASHI-ESMGISIDMI------VRIYVIIARVYNLHDIWSELDRVDgAIGVDD 1398 Anapla...
Q2GG64              1284 YIRQHPLKKEILATCIVNDIVNRMGCIFVNHIIENIGITVEDI------IKIYVITTHIYNLYEIWKTLDELDsKVHINV 1357 Ehrlic...
mmlSJTU:SCATT_19950 1440 LTRVRLHSRRLVERGTR----------------------WLLNNRPQPLA-IAETI--DFFGEGVAAVWA----QLPKLL 1490 Strept...
jgi:Xaut_1432       1400 QLGLYAAVQDLVVGRTI----------------------WFLGNVSFA-DgIAGVV--ERYRTGIAAVAA----VLEESL 1450 Xantho...
WP_012333450        1403 QLALYAELQDLLRQRMV----------------------WFIRHESLGEGgIDAVV--ARYRDGIAAVAS----SLSSVL 1454 Methyl...
jgi:Mrad2831_0077   1402 QLDLYAEVQDLLTNRIV----------------------WFIRNLDLS-GgLAPVV--ARYRDGIAAVEA----ALPKVL 1452 Methyl...
jgi:M446_3850       1402 QLSLYAEVQDLLANRIV----------------------WFIRNLDLA-VgLSPII--ARYRDGVAAVEA----ALPKVL 1452 Methyl...
WP_013176905        1395 QYAMLERFVAAVEGVVA----------------------WLLLN-DIPVAsVGTFV--ETYKAPLSALRE----GLAALL 1445 Truepe...
jgi:Hipma_0217      1378 IYKISLDMFDAVNSFTIneiymfrdgvsldtkkeeeikgWLNDYY---STcVEEGLyhESYLKKVDDLKS---------- 1444 Hippea...
WP_011713118        1398 KYQVLADMEGVLLHLAA----------------------WMLTHLSSDRI-TVDVI--NLYGKVIGAFQGrlwdSLPELL 1452 Magnet...
Q2GKF6              1399 YVRIVRKVQKFVGQATF----------------------WLFRHMHKFSD-IEKRL--DSLSEKTLLLES----QLTNVL 1449 Anapla...
Q2GG64              1358 YTSLIREVQKFIGQVTF----------------------WFLRNSSKITN-IDTKL--DELSSQISSLEE----NIESIL 1408 Ehrlic...
mmlSJTU:SCATT_19950 1491 RGADQAWYQQIHDELTGAGVPEELANRVAGFSSAFPTLDIVAVADRTRKDPLEVAEIYYDLADRLRITQLLDRIIEL-PR 1569 Strept...
jgi:Xaut_1432       1451 PEAWRREREARMADLIGQNVPEDLARKIAFMPGLAAASDIALIAETTGKSIPSAASTFFAAGRTFAIDDLFMQARSI-LA 1529 Xantho...
WP_012333450        1455 PAGAREALAKRGRSLADQGVPEPLAGQLAALAELGAAPDIVRVAEATGRPPVAIAATHFAIEELFRLGPLTRAARAV-PV 1533 Methyl...
jgi:Mrad2831_0077   1453 GDEALATIGARESELTGHGMAPAQARRLASLGALVSGPDIVRVAEASGRPVEEVAATHFALEHAFRLDDLAAAARTV-PV 1531 Methyl...
jgi:M446_3850       1453 GEEAWAVIEARVAELTGAGMAPVQARRLASLTAMVSAPDIVRVAEVSGRPVEEVAATHFAIEHAFRLGDLAAAARTV-AV 1531 Methyl...
WP_013176905        1446 PAAERARYEGTLQEIVALGFEGPLAAELASLEYLPSSVGVVDVSRNTATPLETAARLFYALGERFSLGALRDALAAL-EA 1524 Truepe...
jgi:Hipma_0217      1445 ------------------VVDETLAKKIARLYFIEPFIPSYHIARLLGKDIKTTVEALDTIDRSFGFKELKGYINSI-HI 1505 Hippea...
WP_011713118        1453 AGEQVNELIKRRKQLVKMGLPESLATDTVLLPYMKDAMTILHIKEALHVPFEPVGHLYIRVDDFFGISWIEENLQQI-RH 1531 Magnet...
Q2GKF6              1450 CDEFLDAYRSAHEDLPKTDINPKVAQRIAGLEFSIFGMDIIDLSENSGVDLATVGRIYFKLRSVLSFSRIRDLATQMdSV 1529 Anapla...
Q2GG64              1409 CNESLEIYNNTLSSLSEHNIEESITKKIIKLKFLTVSLDIIHLTNSSNLPLLTVGKIYFQLRSLLNFSRIRDLAAHMeSN 1488 Ehrlic...
mmlSJTU:SCATT_19950 1570 ADRWQSMARAAIREDLFAAHAALTQDVL--Sa---------gDGSGSPEQRFAAWEGKNAALLGRARTTLDEIQGSESFD 1638 Strept...
jgi:Xaut_1432       1530 PDYYDRLALDRSLAQLETFMRRITELML--------------VDDVAGEAAVNAFICARHEEVERMRRTVREIAA-SGLS 1594 Xantho...
WP_012333450        1534 SDTFDRIALERAVAGIAAAHRALTAEAA--------------ATGAQGQAAVESWSAARGASLARIRTAVSAIAA-SGLT 1598 Methyl...
jgi:Mrad2831_0077   1532 ADTFDRVALERAGAGIAAAHRKLTAEVV--------------ADLGAGPDAVEAWIRARGAPLARIREAVDAISA-SGLT 1596 Methyl...
jgi:M446_3850       1532 ADTFDRVALDRAVTGIASAHRKLTAEVI--------------ADIGAGPEAVSAWIRARGSARTRIRDTVDAIAA-SGLT 1596 Methyl...
WP_013176905        1525 RSKWDKIALNGLVMDLRRAQLGLTEQLLveG-----------GDASDPAAAVEGFLARHPRLLRRFDAALAEIRQEDALG 1593 Truepe...
jgi:Hipma_0217      1506 ANEWDRMAQFSVIRNYILAEITMAIRLI-----------------KEFAGDINAMIESKREVYDEYKTDLDTIMGIKSIN 1568 Hippea...
WP_011713118        1532 RDIWGRMNLENVRKELWETRTRLVKKIIsfK-----------RQNESVGDAFQSYINEVSGANKEYMALFSELKAQSKHD 1600 Magnet...
Q2GKF6              1530 SPYWQRIAIRNLLDDLSDYQSIIAKNIIkhmipkqs--dmqesvdTVAQESVAAWCEQHRNQLDGYYRFLEDINSA-QLD 1606 Anapla...
Q2GG64              1489 SSYWQRIAIRNLLDDLNDYQFIITESILkqveptlslavkldkvhSIINDIIQSWYIKNQEKLNRYYNFLNEINTT-QLD 1567 Ehrlic...
mmlSJTU:SCATT_19950 1639 LANLSVAMRTMRT 1651 Streptomyces cattleya NRRL 8057 = DSM 46488
jgi:Xaut_1432       1595 LSKLTLAASLLSD 1607 Xanthobacter autotrophicus Py2
WP_012333450        1599 VSKVSVAASLLAD 1611 Methylobacterium sp. 4-46
jgi:Mrad2831_0077   1597 VSKATVAASLLGD 1609 Methylobacterium radiotolerans JCM 2831
jgi:M446_3850       1597 LSKTTVAASLLGD 1609 Methylobacterium sp. 4-46
WP_013176905        1594 LASGGVLSRLLwq 1606 Truepera radiovictrix
jgi:Hipma_0217      1569 LHPAMLLYDKLQK 1581 Hippea maritima DSM 10411
WP_011713118        1601 LLPLSVLVRKLRE 1613 Magnetococcus marinus
Q2GKF6              1607 LSKLVLIIRSLSv 1619 Anaplasma phagocytophilum str. HZ
Q2GG64              1568 LSKLMLIIKSLDm 1580 Ehrlichia chaffeensis str. Arkansas
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap