Conserved Protein Domain Family
GRA6

?
pfam05084: GRA6 
Granule antigen protein (GRA6)
This family contains the granule antigen protein GRA6 which is found in the parasitic protozoa Toxoplasma gondii and Neospora caninum. GRA6 protein plays an important role in the antigenicity and pathogenicity in these organisms.
Statistics
?
PSSM-Id: 398656
Aligned: 2 rows
Threshold Bit Score: 315.84
Threshold Setting Gi: 557735184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESS31241   1 MAHGGIHLRQKRNFCPLTVSTVAVVFVVFMGVLVNSLGGVAVAADSDGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGG 80  Toxoplasma gondii VEG
KEP62654   1 MVHGGIYLRQKRNFCPFTVVTAAVSFVLFVGMFVSSLGGAAVAAEGGGVRNAPSETGSSVGQQEAVGTTEEYVNSSAMGG 80  Hammondia hammondi
ESS31241  81 GQGDSLAE-DDTTSDAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRLIGAVVL 159 Toxoplasma gondii VEG
KEP62654  81 GQGDSFAEdDDITSDVAEGDVDPFPALEKEGKSEARGPSLEEKIEEQRPRRRPSSVQEPQAKVSSKRAQKRHRLIGAIVL 160 Hammondia hammondi
ESS31241 160 AVSVAMLTAFFLrRTGRRSPPEPSGDGGGNDAGNNAGNRGNEGRGYGGRGEGGGED 215 Toxoplasma gondii VEG
KEP62654 161 AASVALLTAFFL-RSGRRAPGGPRGENDGGNGGDNSGNGENRGRGEGAGGEGDGGD 215 Hammondia hammondi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap