3CSX


Conserved Protein Domain Family
Rop-like

?
pfam05082: Rop-like 
Click on image for an interactive view with Cn3D
Rop-like
This family contains several uncharacterized bacterial proteins. These proteins are found in nitrogen fixation operons so are likely to play some role in this process. They consist of two alpha helices which are joined by a four residue linker. The helices form an antiparallel bundle and cross towards their termini. They are likely to form a rod-like dimer. They have structural similarity to the regulatory protein Rop, pfam01815.
Statistics
?
PSSM-Id: 398654
Aligned: 56 rows
Threshold Bit Score: 60.6379
Threshold Setting Gi: 333808792
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CSX_A         16 AVADLKKKVRKLNSKAGQMKMDLHDLAEG-LPTDYENLVETAEKTYEIFRELDQLKKKLNI 75  Cyanothece
WP_013444926    5 EIKEIEKAVTKARFILSQKAGALHDLIEDrLPADYMEIPEYAEATYLACKAWDELNKKLIE 65  Paludibacter propionicigenes
CAL93174        5 EIKELEKEVKKLKRISQEWASQLHDLVEDrLPAGYEEIHGISQSTYDACKAWADANKRLIA 65  Azoarcus sp. BH72
WP_011912514    5 ELKALKKEVSQKKRIATEWASQIHDLVEDrLLIDYRQLPELATQAHQACLDWAEANARLEA 65  Pseudomonas
jgi:Thivi_2735  5 DIKALEKAVSKAKRIASEKASEMHDLVEDrLPAAYEEIPGIAQSTYDACRAWAEAVAKLKA 65  Thiocystis violascens DSM 198
WP_005224773    5 hrQGLERAARKAKRIANERAAELHDLVEErLPGAYAELPALAQTTYDACLAWAEADARLKA 65  Marichromatium purpuratum
jgi:Thimo_3541  5 ELQALRKEVKRAKRIASEKAGELHDLVEErLPQAYKDIPAVSQACFDACEAWAELNARLNA 65  Thioflavicoccus mobilis 8321
Q47FX3          5 EIAALDKEVKKLKRIASEWASQMHDLVEDrLPAAYHEIPGIAQSTFDACQTWAEASARLAA 65  Dechloromonas aromatica RCB
WP_015768759    5 DIRELDRQVKKLKRLAGEQAARLHDLVEDrLPAAWQELPEISQATLAACQAWAEANARLQA 65  Candidatus Accumulibacter phosphatis
jgi:Metme_3084  5 ELKKLEKEVKKAKRLAGEAAMELHDLIEDrLPDAYGELMAVAQNTYEACKVWDEANQKFLA 65  Methylomonas methanica MC09
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap