Conserved Protein Domain Family
Menin

?
pfam05053: Menin 
Menin
MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumor suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23.
Statistics
?
PSSM-Id: 398642
Aligned: 6 rows
Threshold Bit Score: 893.132
Threshold Setting Gi: 195401174
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAQB:GK24291-PA  20 LIDAS---LFPLKSTSDVVNLFRRSLtetsnSGIEPDLTLLSIIVGYIELSLTTGEaaaqaaqaaaqaaasaatdpcltn 96  Drosophi...
Q9VM47               18 VIDAS---LFPLKSTADVINLFRRALt----SGIEPDLTLLSIVVGYIELSLTTGEaaaqaaqaaaaava--------ag 82  fruit fly
XP_002059189         19 IIDAS---LFPLKSTSDVVNLFRRALt----SPIEPDLTLLSIVVGYIELSLTTGEaaqaaqaaq--------------- 76  Drosophi...
XP_009244445          2 GLKAAqktLFPLRSIDDVVRLFAAEL-----GREEPDLVLLSLVLGFVEHFLAVNR------------------------ 52  Sumatran...
Q503J8                2 GIRSTqkkHFPLRGIDGVVQLFESEL-----NSPEPDLALLSLVLGFVEHFLAVNR------------------------ 52  zebrafish
XP_023202917          2 GLHSTqkkFFPLKGIDGVVQLFDSEL-----RKSEPDLALLSLVLGFVEHFLAVNR------------------------ 52  southern...
WGS:AAQB:GK24291-PA  97 stgatassnhdvIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVMD---KPKPHRQATREIIKK 154 Drosophi...
Q9VM47               83 disqattggndiIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVVE---KPKPHRQATREVIKK 140 fruit fly
XP_002059189         77 ---aalgggsdvIMGNSVP------------------FPVVTHELIAGLYKKFQT-ILSVVE---KPKPHRQATREIIKK 131 Drosophi...
XP_009244445         53 ------------VIPTNVPeltfqpspapdppggltyFPVADLSIIAALYARFTAqIRGAVDlslYPREGGVSSRELVKK 120 Sumatran...
Q503J8               53 ------------VVPVNVPgvrfeplq---pdslnscFPTVELNLLSALYERFMAqIRGAVDmsqYRKPSGASSRELVKK 117 zebrafish
XP_023202917         53 ------------VIPINVPgvrfeple---pdcptscFPTVELGMISALYERFTAqIRGAVDlsqYRRTASGSSRELVKK 117 southern...
WGS:AAQB:GK24291-PA 155 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALAVVAGCQLLGYKDVRLAISEDHAWVVFGQKpRLETIEVTWH 234 Drosophi...
Q9VM47              141 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALAVVAGCQLLGYKDVRLAISEDHAWVVFGQK-RVETIEVTWH 219 fruit fly
XP_002059189        132 VSDVIWNSLIRSSYKDRAHLQNLYSYLSGNKLDCFGVALATTAGCQLLGYRDVRLAISEDHAWVVFGQK-HVESIEVTWH 210 Drosophi...
XP_009244445        121 VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPN-GEQTAEVTWH 199 Sumatran...
Q503J8              118 VSDVIWNSLSRSYFKDRAHIQSLFSLITGTKLDSSGVAFAVVAACQVLGLKDVHLALSEDHAWVIFGKG-GEETAEVTWH 196 zebrafish
XP_023202917        118 VSDVIWNSLSRSYFKDRAHIQSLFSLITGTKLDSSGVAFAVVAACQVLGLKDVHLALSEDHAWVIFGKN-GEETAEVTWH 196 southern...
WGS:AAQB:GK24291-PA 235 GKGSEDKRGQDINAGIESGSWLYLGGLAVVCERGMEVAAICAALNISLTANSDCVEVAELQQQLLWMLYDLGHLKRYPMA 314 Drosophi...
Q9VM47              220 GKGSEDKRGQDIRPGIESGSWLYLGGLAVVCERGMEVAAICAALNISLTSNSDCVEVAELQQQLLWLLYDLGHLKRYPMA 299 fruit fly
XP_002059189        211 GKGSEDKRGQDISAGIESGSWLYLGGLAVVCERGMEVAAICVALNISLSANSDCVEVAELQQQLLWLLYDLGHLKRYPMA 290 Drosophi...
XP_009244445        200 GKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMA 279 Sumatran...
Q503J8              197 GKGNEDRRGQTVSAGINERSWLYLKGSYMKCNRNMEVAFMVCAINPSLDLHTDSTELIQLQQRLLWLLYDRGDLERYPMA 276 zebrafish
XP_023202917        197 GKGNEDRRGQTVTAGVSEKSWLYLKGSYMKCDRNMEVAFMVCAINPSLDLHTDSSELLQLQQKLLWLLYDRGDLDRYPMA 276 southern...
WGS:AAQB:GK24291-PA 315 LGTLGELEEINPTHRTITCEQLYREAIESSRLYYRNHHVYPYTYQGNYYNRLLKYRDAFAAWANAADVIRLYTYqCRDDE 394 Drosophi...
Q9VM47              300 LGTLGELEEIHRTHPSISCEQLYREAIESARTHYRNHHVYPYTYQGNYYNRLLKYRDAFAAWANAADVIRLYTYqCRDDE 379 fruit fly
XP_002059189        291 LGLLGELEEIHRTHRSISCEQLFREAIDSARNYYHNHHVYPHIFQGNYYNRLLKYREAFAAWANAADVIRLYTYqCRDDE 370 Drosophi...
XP_009244445        280 LGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNY-CREDE 358 Sumatran...
Q503J8              277 MGTLADLEDQEPMTGKESPLSIHLKAVESAKKYYNNEHIYPYMYLAGYHYRHRDVREALGSWAEAASVMQDYNY-CREDE 355 zebrafish
XP_023202917        277 MGTLADLEDQEPIPGKENPLQIHLKAVGSAQKFYNNEHIYPYMYLAGFHYRHRNVQEALKAWAEAAQVMQEYNY-FREDE 355 southern...
WGS:AAQB:GK24291-PA 395 EIYKELLDIANELIPYVMKSESSG--------------------HSARSILRDAEVFANLLRFYDGICQWEEDSLTPILH 454 Drosophi...
Q9VM47              380 EIYKELLDIANELIPYVMKTESSG--------------------HSARSILRDSEVFANLLRFYDGICQWEEDSLTPILH 439 fruit fly
XP_002059189        371 EIYKELLDIANELIPYVMKTESSG--------------------HSARSILRDAEVFANLLRFYDGICQWEEDSLTPILH 430 Drosophi...
XP_009244445        359 EIYKEFFEVANDVIPNLLKEAASLleageerp-----geqsqgtQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLH 433 Sumatran...
Q503J8              356 EIYKEFFDIANDVIPTLLKETAAAaesegtdea---ekedqpreAAALTALQDPECFAHLLRFYDGICKWEEGSPTPVLH 432 zebrafish
XP_023202917        356 EIYKEFFDIANDVIPTLLKETATAdgpgedgdgaegpdkengkqMTAISALQDPECFAHLLRFYDGICKWEEGSPTPVLH 435 southern...
WGS:AAQB:GK24291-PA 455 IGWAKPLVNNITKFDYDVRSQVMIKLPEdleaeqqq---aaaaaaaAEAAKQEDAKREAAllqLEGnNNIninsMVKKDE 531 Drosophi...
Q9VM47              440 IGWAKPLVNNITKFDYDIRSQVVIKLPEdleaeqakaelaraeqeaKEAKESKEAAGSEA---MEGnNNR----MATKEE 512 fruit fly
XP_002059189        431 IGWAKPLVTNITKFDYDIRSQVVIKLPEdleaeqaaa-leakkaaaAAAAATTAAAAAEAtlhLEGnNNNnnntLAKKDE 509 Drosophi...
XP_009244445        434 VGWATFLVQSLGRFEGQVRQKVRIVSRE------------------AEAAEAEEPWGEEA---REG-RRRgprrESKPEE 491 Sumatran...
Q503J8              433 VGWATYLVQSLSRFDAQIRQKVSIITKD------------------TEPVDDDDQSSEDL---REG-RRRgprrESKLDE 490 zebrafish
XP_023202917        436 VGWATYLVQSLSRFDSQVRQKVSIITKE------------------PECQDDDDQSSEDP---REG-RRRgprrESKLED 493 southern...
WGS:AAQB:GK24291-PA 532 KSKPSEqLPTTLADltaacgekilnpdfllqggNQPFAEQKQQNNSAGNEPTEannnnsshnnsekeaktsstitatiat 611 Drosophi...
Q9VM47              513 KSKNSE-LPTTLADltaacgekilnpdfllqggGQPFADQKQQPSGGESDNPElhnnnnnsnsnnnnn-nhnadkkeaaa 590 fruit fly
XP_002059189        510 KSK-SE-LPTTLADltaacgekilnpdfllqggGQPFADQKQQAAAEQTTSSDlshnnnnnik-----------tssske 576 Drosophi...
XP_009244445        492 -----PpPPKKPAL-------------------DKGLGTGQ----GAVSGPPR--------------------------- 516 Sumatran...
Q503J8              491 PAGSASpNPALPAQ-------------------NQ---NPVPKKVGGEGGRRR--------------------------- 521 zebrafish
XP_023202917        494 QSSSPPtAPTSPPS-------------------QQPAAAPQPKKVGDGAVRRR--------------------------- 527 southern...
WGS:AAQB:GK24291-PA 612 attsTSTTSNGGSSSS----SGNPNATIETPQEpkeakleekqk--qievkapptptDDyeeyvqimlkrPVITLYSQKM 685 Drosophi...
Q9VM47              591 tttnATTTSNGSGTSVqlpvSSEANNAGQAQSQvqindqlgkpq---hkeakkeetsDDydpfe-imlkrPVITLYSQKM 666 fruit fly
XP_002059189        577 adkeATTTSNGGGSGSnlthSPSTEAQMQSPSQsqhkeakleessqlelasskpaavDDydpfe-imlkrPVITLYSQKM 655 Drosophi...
XP_009244445        517 ----KPPGTVAGTARGp---EGGSTAQVPAPaasp--------------------ppeG-----------PVLTFQSEKM 558 Sumatran...
Q503J8              522 ----SSASTRGKEADGknepSSPS--PIPSPsqpp-------------------avqGG-----------PVVVFHSEKM 565 zebrafish
XP_023202917        528 ----SSQGLRAGETDGt--pKSPSSESVSSPLSqqlas----------------pcpaG-----------PVVVFQSEKM 574 southern...
WGS:AAQB:GK24291-PA 686 KGLKDLLLAEKLNTHAISLQVTAQSVASRKvrg-vaEKQQTATISATITAITTESG 740 Drosophila willistoni
Q9VM47              667 KGLKDLLLAEKLNTHAISLQVTAQSVASRKvr---gVEKHSATISATITAISSSSG 719 fruit fly
XP_002059189        656 KGLKDLLLAEKLNTHAISLQVTAQSVASRKvrgggaDSRQPATISATITAIASTEG 711 Drosophila virilis
XP_009244445        559 KGMKELLVATKINSSAIKLQLTAQSQVQMK------KQKVSTPSDYTLSFLKRQRK 608 Sumatran orangutan
Q503J8              566 KGMKELLSAAKVNSSAIKLQLTAQSQVQMK------RQKPTASGDYTLSFMKRPRK 615 zebrafish
XP_023202917        575 KGMKELLCAAKVNSSAIKLQLTAQSQVQMK------RQKSTPAGDYSMSFMKRQRK 624 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap