5FPH


Conserved Protein Domain Family
IIGP

?
pfam05049: IIGP 
Click on image for an interactive view with Cn3D
Interferon-inducible GTPase (IIGP)
Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defense. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing.
Statistics
?
PSSM-Id: 398639
Aligned: 6 rows
Threshold Bit Score: 566.344
Threshold Setting Gi: 81882103
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FPH_E  45 SQEILNLIELRXRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTXERHPY 124 house mouse
Q62293  22 SEYDITLIMTYIEENKLQKAVSVIEKVLRDIESAPLHIAVTGETGAGKSTFINTLRGVGHEEKGAAPTGAIETTMKRTPY 101 house mouse
Q61635  40 SPETLTGIHKALQEGNLSDVMIQIQKAISAAENAILEVAVIGQSGTGKSSFINALRGLGHEADESADVGTVETTMCKTPY 119 house mouse
Q60766  42 LPEVSRSTERALREGKLLELVYGIKETVATLSQIPVSIFVTGDSGNGMSSFINALRVIGHDEDASAPTGVVRTTKTRTEY 121 house mouse
Q9DCE9  50 SPEVIEDIGKAVTEGNLQKVIGIVKDEIQSKSRYRVKIAVTGDSGNGMSSFINALRFIGHEEEDSAPTGVVRTTKKPACY 129 house mouse
Q9Z1M2  30 SVGVIKRIETAVKEGEVVKVVSIVKEIIQNVSRNKIKIAVTGDSGNGMSSFINALRLIGHEEKDSAPTGVVRTTQKPTCY 109 house mouse
5FPH_E 125 KH-PNIPNVVFWDLPGIGSTNFPPNTYLEKXKFYEYDFFIIISATRFKKNDIDIAKAISXXKEEFYFVRTKVDSDITNEA 203 house mouse
Q62293 102 PH-PKLPNVTIWDLPGIGTTNFTPQNYLTEMKFGEYDFFIIISATRFKENDAQLAKAIAQMGMNFYFVRTKIDSDLDNEQ 180 house mouse
Q61635 120 QH-PKYPKVIFWDLPGTGTPNFHADAYLDQVGFANYDFFIIISSSRFSLNDALLAQKIKDAGKKFYFVRTKVDSDLYNEQ 198 house mouse
Q60766 122 SS-SHFPNVVLWDLPGLGATAQTVEDYVEEMKFSTCDLFIIIASEQFSSNHVKLSKIIQSMGKRFYIVWTKLDRDLSTS- 199 house mouse
Q9DCE9 130 SSdSHFPYVELWDLPGLGATAQSVESYLEEMQISTFDLIIIVASEQFSSNHVKLAITMQRMRKRFYVVWTKLDRDLSTS- 208 house mouse
Q9Z1M2 110 FS-SHFPYVELWDLPGLGATAQSVESYLEEMQISIYDLIIIVASEQFSLNHVKLAITMQRMRKRFYVVWTKLDRDLSTS- 187 house mouse
5FPH_E 204 DGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLXDELISDLPIYKRHNFXVSLPNITDSVIEK 283 house mouse
Q62293 181 KFKPKSFNKEEVLKNIKDYCSNHLQESLDSEPPVFLVSNVDISKYDFPKLETKLLQDLPAHKRHVFSLSLQSLTEATINY 260 house mouse
Q61635 199 KAKPIAFKKEKVLQQIRDYCVTNLIKTGVTEPCIFLISNLDLGAFDFPKLEETLLKELPGHKRHMFALLLPNISDASIEL 278 house mouse
Q60766 200 -----VLSEVRLLQNIQENIRENLQKEKVKYPPVFLVSSLDPLLYDFPKLRDTLHKDLSNIRCCEPLKTLYGTYEKIVGD 274 house mouse
Q9DCE9 209 -----TFPEPQLLQSIQRNIRENLQQAQVRDPPLFLISCFSPSFHDFPELRNTLQKDIFSIRYRDPLEIISQVCDKCISN 283 house mouse
Q9Z1M2 188 -----TFPEPQLLQSIQRNIRDSLQKEKVKEHPMFLVSVFKPESHDFPKLRETLQKDLPVIKYHGLVETLYQVCEKTVNE 262 house mouse
5FPH_E 284 KRQFLKQRIWL-EGFAADLVNIIPSLTFLlDSDLETLKKSXKFYRTVFGVDETSLQRLARDWEIEVDQVEAXIKSPAVFK 362 house mouse
Q62293 261 KRDSLKQKVFL-EAMKAGALATIPLGGMI-SDILENLDETFNLYRSYFGLDDASLENIAQDLNMSVDDFKVHLRFPHLFA 338 house mouse
Q61635 279 KKHFLREKIWL-EALKSAAVSFIPFMTFFkGFDLPEQEQCLKDYRSYFGLDDQSIKEIAEKLGAPLADIKGELKCLDFWS 357 house mouse
Q60766 275 KVAVWKQRIAN-ESLKNSLg----------VRDDDNMGECLKVYRLIFGVDDESVQQVAQSMGTVVMEYKDNMKSQNFYT 343 house mouse
Q9DCE9 284 KAFSLKEDQMLmKDLEAA-VSs--------EDDTANLERGLQTYQKLFGVDDGSLQQVARSTGR----LEMGSRALQFQD 350 house mouse
Q9Z1M2 263 RVESIKKSIDE-DNLHTEFg----------ISDPGNAIEIRKAFQKTFGLDDISLHLVALEM--KNKHFNTSMESQETQR 329 house mouse
5FPH_E 363 PTDEETIQERLSRY-IQEFCLANG------YLLPKNSFLKEIFYLKYYFLDXVTEDAKTLLKEI 419 house mouse
Q62293 339 EHNDESLEDKLFKY-IKHISSVTG------GPVAAVTYYRMAYYLQNLFLDTAANDAIALLNSK 395 house mouse
Q61635 358 LVKDNSIIAQATSA-AEAFCAVKG------GPESSAFQALKVYYRRTQFLNIVVDDAKHLLRKI 414 house mouse
Q60766 344 LRREDWKLRLMTCAiVNAFFRLLr------FLPCVCCCLRRLRHKRMLFL--VAQDTKNILEKI 399 house mouse
Q9DCE9 351 LIKMDRRLELMMCFaVNKFLRLLEsswwygLWNVVTRYFRHQRHK--LVIEIVAENTKTSLRKA 412 house mouse
Q9Z1M2 330 YQQDDWVLARLYRTgTRVgsi------gfdYMKCCFTSHHSRCKQQKDILDETAAKAKEVLLKI 387 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap