2LMD,1XPX


Conserved Protein Domain Family
HPD

?
pfam05044: HPD 
Homeo-prospero domain
Prospero is a large drosophila transcription factor protein that is expressed in all neural lineages of drosophila embryos. It is needed for correct expression of several neural proteins and in determining the cell fates of neural stem cells. homologs of prospero are found in a wide range of animals including humans with the highest level of similarity being found in the C-terminal 160 amino acids. This region was identified as containing an atypical homeobox domain followed by a prospero domain. However, the structure shows that these two regions form a single stable structural domain as defined here. This homeo-prospero domain binds to DNA.
Statistics
?
PSSM-Id: 398635
Aligned: 14 rows
Threshold Bit Score: 311.271
Threshold Setting Gi: 405977161
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LMD_A         16 GLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEE--LSIT 93  
XP_026049820  344 GLTTNHLKKAKLMFFYTRYPSSLVLKMCFHDVQFTRSITSQLIKWFSNFREFYYIQMEKFARHALIEGVADVRG--LTVG 421  eastern happy
XP_016846775  488 ALTPGHLKKAKLMFFFSRYPTSSLLRAYFLDVQFTRCITSQLIKWFSNFREFYYIQMEKCARQALLEGVADSSR--LLVT 565  green anole
CAP39453      467 MLTPMHLRKAKLMFFYTRYPSSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYIQMEKFARQALSEGISDRSE--IFVS 544  Caenorhabditi...
EFX75472      830 TLTPMHLRKAKLMFFWCRYPSSSVLKTFFPDVNFNKNNTAQLVKWFSNFREFYYIQMEKYSRQLLSEGVVNADD--IHVS 907  common water ...
EKC41624       24 TLTPMHLRKAKLMFFYVRYPSSAILKVYFPDVKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAIAEGCKSIDD--LVVT 101  Pacific oyster
XP_002427668 1075 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIMFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVSEGIKNAED--IHVS 1152 human body louse
Q4H2W8        502 GLTSQHLKKSKLMFFYTRYPCVTTLKSYFSDVQFSRATTSQLIKWFSNFREFYYMQMERFARQALVDGITEAEQ--ILVG 579  vase tunicate
Q4H2W9        330 GLTPQHLKKAKLMFFYTRYPSANMLKAYFADVKFSRATTSQLIKWFSNFREFYYIQMEKFARQALTEGITDVNQ--ILVT 407  vase tunicate
XP_007248093  544 GLSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREGLPTSRDrvLRLS 623  Mexican tetra
2LMD_A         94 RDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNC 167 
XP_026049820  422 RESELFRALNRHYNKASDFQVPDRFLEVAEITLREFYVAISMGKDRDPSWKKAIYKVICKLDTDVPAEFKSHhs 495  eastern happy
XP_016846775  566 RGSELFRILNVHYNKGNDFEVPDAFLDVASLTLQEFFNAVREGKDLDPSWKKPIYKIISKLDSEIPDAFKSSNC 639  green anole
CAP39453      545 KDSELFKVLNTHYNRNNHIKAPDRLVLVVQETLREFYDAIKLGKDAEPSWKKTIYKIINRLDDQIPDFFKEPNF 618  Caenorhabditis brig...
EFX75472      908 PDSELFRALNLHYNRNNHIEVPAPFVFVVSETLREFFKAIQAGKDSEPSWKKAIYKIIARLDEQVPEYFRTPNF 981  common water flea
EKC41624      102 TESELYRVLNLHYNRNNQIEVPDNFRIVVQATLREFYKSIVACKDSEPSWKKAIYKVIARMDDSLPEYFKSPNW 175  Pacific oyster
XP_002427668 1153 ADSEIYRVLNLHYNRNNHIEVPSNFRFVVEQTLREFFKAIQTGKDTEQSWKKSIYKIISRMDDPVPDYFKSPNF 1226 human body louse
Q4H2W8        580 RNSEVFHILNIHYNKSNDFEAPQHFLDVVTKTIRNFFTNIKYGKDNEAGWKKVIYKVICKLDQDIPEIFKSPNV 653  vase tunicate
Q4H2W9        408 RDSEILRVLNLHYNKSNDFRVPDQFIDVTQTSLQEFYLSIKAGKDRDPAWKKVIYKVICKLDHDVPDIFKSANV 481  vase tunicate
XP_007248093  624 RNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFRLPGC 697  Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap