4R6I,3SQN


Conserved Protein Domain Family
Mga

?
pfam05043: Mga 
Click on image for an interactive view with Cn3D
Mga helix-turn-helix domain
M regulator protein trans-acting positive regulator (Mga) is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions. This domain is found in the centre of the Mga proteins. This family also contains a number of bacterial RofA transcriptional regulators that seem to be largely restricted to streptococci. These proteins have been shown to regulate the expression of important bacterial adhesins. This is presumably a DNA-binding domain.
Statistics
?
PSSM-Id: 398634
Aligned: 26 rows
Threshold Bit Score: 59.1299
Threshold Setting Gi: 81592969
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4R6I_B  78 LNESLSFVESKILRK---------------SLNLQICEELV-FKKNSXQSLAQKLHLQVGALYPIINQINYDIQ-SSHLN 140 Bacillus anthracis st...
Q8Y9R4  79 DNCSIQLIINAYIRE---------------SPKFQILETLLlASFPNLQALAKKVHVSYSGIKKEIKELNEELR-ERNLS 142 Listeria monocytogenes
Q8DP24  79 VNTSVEDIYQYFLAN---------------SQSFQLLEYMFfNEGLPIYRTIENLYFSSANLYRLGRNITKVLSsQFQIE 143 Streptococcus pneumon...
Q8DNN5  90 ddSDIEMVYHHFFKH---------------STHFSILEFIFfNEGCQAESICKEFYISSSSLYRIISQINKVIKrQFQFE 154 Streptococcus pneumon...
Q99Z99  69 HSMAFDIFWQESVTSkkrladvtqveesvdREDYVLHKFFFeDAVQDFEELCQELYISRTTLKHVLAGIKERII-PYQLE 147 Streptococcus pyogene...
Q99XU9  75 qHCGLQEVYQKALRH---------------SQSFKLLETLFfRDFNSLEELAEELFVSLSTLKRLIKKTNAYLMhTFGIT 139 Streptococcus pyogene...
Q9RMX9  69 YNKHRNEITFLLFRE---------------SLTFRILQHLFeRETKTIATLAERLYIQVPSILPALKRVENYLK-KFGLK 132 Bacillus anthracis
Q8YA62  67 eqLSQMNLTKN--NE---------------NLHFELLRHIIeQDHTNFYDLADQFFISESTLARIIKELNIVIA-EKDES 128 Listeria monocytogenes
Q8Y9S8  81 LGADVLNFELYLLEE---------------NVTIILMKAIFfEEFTSVKKFAMDYFLSETTIRRSLKYFQELLE-PYGIK 144 Listeria monocytogenes
Q831K2  79 LRISSSIIEEYYLKD---------------SLEFNLLKTIFfHQFTSIKKYGEKHGMSRTVVYKIVDHIRKELG-QYGIK 142 Enterococcus faecalis
4R6I_B 141 I---KKKPLEIS-GREQDVRVFXLRLY 163 Bacillus anthracis str. 'Ames Ancestor'
Q8Y9R4 143 Is--TGNQVEIT-GDEFSLRIFYAFLF 166 Listeria monocytogenes
Q8DP24 144 L---SFTPSEIR-GNEIDIRYFFAQYF 166 Streptococcus pneumoniae R6
Q8DNN5 155 V---SLTPVQII-GNERDIRYFFAQYF 177 Streptococcus pneumoniae R6
Q99Z99 148 Le-iTHQHIQIR-GKEEDIRHFIMDYF 172 Streptococcus pyogenes serotype M1
Q99XU9 140 I---LTSPVQVS-GDEHQIRLFYLKYF 162 Streptococcus pyogenes serotype M1
Q9RMX9 133 L---RKKPLRLE-GDEVRIMIMYLDLY 155 Bacillus anthracis
Q8YA62 129 LciiRKNNELLTeGGEEEKRRIFNLFl 155 Listeria monocytogenes
Q8Y9S8 145 L---KRETYEVV-GPEEQVRMFFYSYF 167 Listeria monocytogenes
Q831K2 143 L----SKNLQLS-GNEMAIRQYFTMLY 164 Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap