1KCZ,1KKO


Conserved Protein Domain Family
MAAL_N

?
pfam05034: MAAL_N 
Methylaspartate ammonia-lyase N-terminus
Methylaspartate ammonia-lyase EC:4.3.1.2 catalyzes the second step of fermentation of glutamate. It is a homodimer. This family represents the N-terminal region of Methylaspartate ammonia-lyase. This domain is structurally related to pfam03952. This domain is associated with the catalytic domain pfam07476.
Statistics
?
PSSM-Id: 398626
Aligned: 41 rows
Threshold Bit Score: 185.463
Threshold Setting Gi: 81424484
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KCZ_A           1 MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTG-STVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGG 79 
EKV04757         6 iqpTDVRFVCGLSGYFHKDLQAVKKSPNYDPLANDI-APVTPGFKQVVQAGEVISILLRLQSGAVAVGECVDVIFSGTAS 84  Penicillium d...
EED45972         1 mHPSDVQFVVGLSGYFVKDLQAVRQSPTYDPLIDNI-RPQTPGFKSVVQAGQAISILIHLPNGTIALGDCADVIFSGAAS 79  Aspergillus f...
XP_011121048     1 MQPIDVQFVVGLSGYFVKDLQAVRQSPQYNPLRDDNiSPRTPGFKSVVQPGQVISILLHLPIGGVAVGDCVDVIFSGAAS 80  Arthrobotrys ...
XP_011114334     1 mlpVDVQFVVGLSGYFVKDLAAVRHSPSYNPLTDTAiRPRTSGFKSVVQPGQVISIILHLPNGSTAIGDCADVIFSGAAS 80  Dactylellina ...
Q7VUC6          11 iRIEAVRVTAGIGGHWINDQMAVQTGATADGYFFEG-PTSSTAFPAVRSPSVAYLVSLDLADGQTAHGDCTTVANAGYAG 89  Bordetella pe...
CCH89416         4 pRIAEVLAVGVRGGFFTDDQAAIRAGAVRDGFGYAG-PPVTPGFTAVRQPAEALSVLLVLDDGSVEFGDCAAVQYAGAGG 82  Modestobacter...
Q9HN19           1 MRIERVTATPGVAGFFFDDQAAITAGADADGMAYAG-SPRTDGYERIREPGEALVVEVVLSDGRRVRGDCAAVQYSGAGD 79  Halobacterium...
ELY68557         2 ttIEDVSATPGMTAFFADDQAAIAAGAEPDGFAYAG-EPETPGFDRIREPGEAVLVELALGDGRVVRGDCAAVQYAGVGE 80  Natronobacter...
jgi:Halru_1550   1 MQIESVVATPGVSGFYFDDQAAIAQGASRDGFVYEG-DPVTAGFDRVRQPGESLVVTLALSDGSTVRGDCAAVQYSGAGG 79  Halovivax rub...
1KCZ_A          80 RDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMT---VNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRD 156
EKV04757        85 RDPLFIPKQHLPLLDMIVRPWLLECDVATFRSNAVKIDQpwpelgnK-RLHTAVRYGLSQALLSATALANKCTITEIVAR 163 Penicillium d...
EED45972        80 RDPLFIAEEHLPILESVVKPRLLTCDVTQFRQNAIVMDGpwpelqhA-KLHSAVRYGITQALLAATALVHRCTMAEIISR 158 Aspergillus f...
XP_011121048    81 RDPLFVADEHLEVLESVVRPWLLGCDISSFRRNGEKVESgwlglhkRSKLHSAIRYGLTQALLAATAQVHGCTIAEVISH 160 Arthrobotrys ...
XP_011114334    81 RDPLFIAEDNLPILHTVVKKWLLSCDLSQFRPNAEYLSStwpqlnnR-KLHSALRYGLSQALLAATAQVYSCTIAEIISR 159 Dactylellina ...
Q7VUC6          90 R-PLPLRREDVQAVQAVLQESLAGRSFAGFREAAGALDAMPl--AD--TLRLPVEYGVSQALLEAAALASRTRMVDVLCR 164 Bordetella pe...
CCH89416        83 RDPVFSASRAREAVLDHVAPRLVGREVTGFRALAEELDRVE---TDGGRLHTAVRYGVSQAVLAAAARAARVTMAEVVRD 159 Modestobacter...
Q9HN19          80 RDPLFRAADHRAVVEGAVAEALVGRDAACVADNAAVVESLAd--ER--GLHTAVRYGVSQALVAAASAARATTQTRVLAD 155 Halobacterium...
ELY68557        81 RDPVFRADDHVELVEGDLRDALVGRPADSLEQNAAVLEELD--------CHSAVEYGVSQALVAAAAAAAETTRTRVLAE 152 Natronobacter...
jgi:Halru_1550  80 RDPLFQAAEYVDLVEGPIADELRGRDAAAFAANTATIESLSp--D-GDRLHTAVRYGLSQALLAAAARAERTTMTDVVAD 156 Halovivax rub...
1KCZ_A         157 EYN 159
EKV04757       164 EWK 166 Penicillium digitatum PHI26
EED45972       159 EWG 161 Aspergillus flavus NRRL3357
XP_011121048   161 EWG 163 Arthrobotrys oligospora ATCC 24927
XP_011114334   160 EWG 162 Dactylellina haptotyla CBS 200.50
Q7VUC6         165 EFG 167 Bordetella pertussis
CCH89416       160 EYR 162 Modestobacter marinus
Q9HN19         156 ALG 158 Halobacterium salinarum
ELY68557       153 ALD 155 Natronobacterium gregoryi SP2
jgi:Halru_1550 157 AVD 159 Halovivax ruber XH-70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap