6OA9


Conserved Protein Domain Family
NPL4

?
pfam05021: NPL4 
Click on image for an interactive view with Cn3D
NPL4 family
The HRD4 gene was identical to NPL4, a gene previously implicated in nuclear transport. Using a diverse set of substrates and direct ubiquitination assays, analysis revealed that HRD4/NPL4 is required for a poorly characterized step in ER-associated degradation after ubiquitination of target proteins but before their recognition by the 26S proteasome. Npl4p physically associates with Cdc48p via Ufd1p to form a Cdc48p-Ufd1p-Npl4p complex. The Cdc48-Ufd1-Npl4 complex functions in the recognition of several polyubiquitin-tagged proteins and facilitates their presentation to the 26S proteasome for processive degradation or even more specific processing.
Statistics
?
PSSM-Id: 398614
Aligned: 23 rows
Threshold Bit Score: 465.186
Threshold Setting Gi: 338818317
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OA9_G       259 RFGYMYGSYSKYDNTPLGIKAVVEAIYEPPQHDEQDGLTMdVEQvkNEMLQIDRQAQEMGLSRIGLIFTDLSDAGAGDGS 338 baker's yeast
CAP27378     151 RVGYLIGQYQPHPEVPLGIKATVAAIYEPPQHCREDGIEF-LED--KNEKIVDKLLEMLGLQRVGWIFTDCWTAARAEGT 227 Caenorhabditis ...
NP_001135712 250 RIGYLYGRYTEHKDIPLGLRAEVAAIYEPPQIGTQNSLQL-LDD--PKAKVVDEIAAKLGLRKVGWIFTDLVSEDTRKGT 326 tropical clawed...
EDO30963     172 RLGFLYGRYEEHKDVPLGIRAVVAAIYEPPQEGTPDSLEL-LPN--TNLDTVNKLAADLGLRIVGWIFSDLVPDDVKKGT 248 starlet sea ane...
Q2HAC4       250 RLGILYGKYMEYDVVPLGIKAVVEAIYEPPQVDEVDGVSL-NPW--ENQEEINTIARYCGLEQVGVIWTDLVDAGMGDGT 326 Chaetomium glob...
A7EGK5       289 RFGYLYGRYEEYTEVPLGVKAVVEAIYEPPQVDELDGITL-NKW--ESEKDVDEMARLCGMERVGVIWTDLLDSGAGDGT 365 Sclerotinia scl...
P0C7N6       275 RLGFLYGRYEEYTEVPLGTKAVVETIYEPPQVNELDGISL-GDW--DNEKEIDEIAAQCGLQRVGVIFTDLLDADKGDGS 351 Parastagonospor...
Q2URI8       287 RLGFLYGTYEEYTEVPLGVKAVVQAIYEPPQVDEIDGVTL-HEW--HNEKEVDEVARLCGLEKVGVIFTDLLDAGQGDGS 363 Aspergillus ory...
Q1DY54       290 RLGFLYGTYEEYSEVPLGVKAVVQAIYEPPQVDEVDGITL-REW--ENERDVDEVAKLCGLEKVGVIFTDLLDSGLGDGT 366 Coccidioides im...
A6R538       292 RLGFLYGTYEEYTEVPLGIKAVVQAIYEPPQVGEVDGVTL-HEW--GNEKDVDEVAKFCGLEKIGVIFTDLLDAGAGD-- 366 Histoplasma cap...
6OA9_G       339 VFCKRHKDSFFLSSLEVIMAARHQTRHPNVSKYSEQGFFSSKFVTCVISGNLEGEIDISSYQVSTEAEALVTADMISGST 418 baker's yeast
CAP27378     228 VHYTRHKDSFFLSAEECITAGMLQNAHPNVTDYSMDRRYGSKFVTVVASGDESMHVNFHGYQVSNQCAAMVEAEILCPTL 307 Caenorhabditis ...
NP_001135712 327 VRYSRNKDTYFLSAEECITSGFFQNKHPNLCRLSPDGHFGSKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCR 406 tropical clawed...
EDO30963     249 VKHLRDINTHFLTAEECIMAGDFQNQYVSPCRYASSGKFGSKFVTVVVSGNDENQIGFDGFQVSNQCMALVRDDCLVPTL 328 starlet sea ane...
Q2HAC4       327 AVCKRHADSYFLASQEVVFAARMQAQHPKPSKWSDTGRFGSNFVTCIISGNEKGEISISAYQMSNDAVEMVRADIVEPSA 406 Chaetomium glob...
A7EGK5       366 VICKRHIDSYYLSSLEIAFAARLQAKHPKPTKWSDTGKFGSNFVTCVVTADETGGIAISAYQVSNTAVEMVRADIVEPSA 445 Sclerotinia scl...
P0C7N6       352 VICKRHIDSYYLSSLEIAFAARYQAKYPRPTKWSETGKFGSNFVTCVISGDDQGQIGISSYQASNDAVEMVRADIIEPSA 431 Parastagonospor...
Q2URI8       364 VICKRHIDSYFLSSLEITFAARLQAQYPKATKWSRTGRFGSNFVTCVLSGDEEGAISVSAYQASVAAVEMVRADIVEPSA 443 Aspergillus ory...
Q1DY54       367 VICRRHIDSYYLSSLEVAFAARLQARYPKPSKWSETGRFGSNFVTCILSGDENGAISISAYQASNSAVEMVRADIVEPSA 446 Coccidioides im...
A6R538       367 ---------------EIVFAAQLQARYPKATKWSETGRFGSNFVTCVLSGDEDGAISISAYQASNSAVEMVKADIIEPSA 431 Histoplasma cap...
6OA9_G       419 F-PSMAYIND--------TTDERYVPEIFYMKSNEYGITVKENAKPAFPVDYLLVTLTHGFPNTDTetnSKF-------V 482 baker's yeast
CAP27378     308 YtPELAYVREt------pLSEAHYITDVQYTEKNEYGAEVLKNGRP-LPVEYLLVDVPAGMPKEPH---YTFhigtmtnS 377 Caenorhabditis ...
NP_001135712 407 DaPELGYAKE--------SSSEQYVPDVFYKDIDKFGNEITQLARP-LPVEYLIIDITATFPKDPV---YTFs------T 468 tropical clawed...
EDO30963     329 DdPGLGYIRE--------SSSEQYVPDVFYKDTDSYGNEVTLLARP-MPIEYLLVQVSAAFPVQPV---YTFsp---ppS 393 starlet sea ane...
Q2HAC4       407 D-PTQMLVRDeeed-dgsPSRTRYIPEVFYRRINEYGANVQENAKPAFPVEYLFVTLTHGFPEAPK---PVF-------- 473 Chaetomium glob...
A7EGK5       446 D-PAVMIVRSegd--ddsDTSARYIPEVFYRKINEYGRSVQENAKPSFPVEYLLVTLTHGFPSDPK---PAF-------M 512 Sclerotinia scl...
P0C7N6       432 E-PSVMLVQSedd--neaLNRARYIPEVFYRRINEHGANVQENAKPDFPVEYLFVTLTHGFPTQPN---PLF-------- 497 Parastagonospor...
Q2URI8       444 E-PSVMLVQSeed---dsENKSRYIPEVFYRKINEYGVSAQQNAKPAFPVEYLLVTLTHGFPTESS---PLF-------- 508 Aspergillus ory...
Q1DY54       447 D-PSVMLVQRenelenadTGNARYIPEVFYRKVNEYGANVQENAKPAFPVEYLFVTLTHGFPTEPS---ALF-------- 514 Coccidioides im...
A6R538       432 D-PGVMLVQQenhs-dddASKARYIPEVFYRKVNEYGANVQENAKPSFPVEYLLVTLTHGFPTDPD---VMF-------- 498 Histoplasma cap...
6OA9_G       483 SSTGFPWSNRQAMGQSQDYQELKKYLFNVAss--gdFNLLHEKISNFHLLLYINSLQILS--PDEWKLLIESAVkNEWEE 558 baker's yeast
CAP27378     378 KNVKFNVENRQAIGQLQGGANLTQYSGEFS------TNQFLELATNFHFLLYLLTNEMVQipEDWVKRLCDAVK-DQDRG 450 Caenorhabditis ...
NP_001135712 469 SSNLFSIENRDALGETQDFHSLATYLSQNL------SSVFLEIISDFHLLLFLVTNDVMPl-QESIGLLLDAVR-TRNEE 540 tropical clawed...
EDO30963     394 NGAVFPIENRENIGELQDFDAVRRHLSQYP------PGDFLSAMSNFHLLVFLATNDMLPl-KTHMEELCAAIK-NKDAE 465 starlet sea ane...
Q2HAC4       474 NNITFPIENREYVGEAQEVSAVAKALRVN-------QKDDSINVSDFHLLCYIHAMGVLA--KEEEALLCRVAT-QNDLA 543 Chaetomium glob...
A7EGK5       513 AKNSFTIENRLVIGQEQDIKDVGKQLGLDKngqltqSSDGVLAVSDFHLLCYIYSMGILS--KEEMALLCRVAT-QHDLA 589 Sclerotinia scl...
P0C7N6       498 TGGKFPIENREIMGEMPDVSALGKSLNAKAnglalnTTSGLNAISNFHMLCFIHNLGILS--KDEESLLFKVAS-THDTS 574 Parastagonospor...
Q2URI8       509 VEGNFPIENREVIGESQELRHVAKKLVSHGd-----PDKAIRAVSDFHLLCFLHSLSTFS--KDEEALLGRVAT-KHDPA 580 Aspergillus ory...
Q1DY54       515 ADTTFPIENREVIGESQDIRNVAKKLLSRSd-----PDEAIRAVSNFHLLCFMHGLGILS--KEEEALLCTVAR-THDPA 586 Coccidioides im...
A6R538       499 NNSTFPIENREVIGESQDLRMLADKLVSHGd-----PNKTICGVSDFHLLCFLNSLGILN--KDEEFLLCTVAR-SHDTA 570 Histoplasma cap...
6OA9_G       559 SLLKL-VSSAGWQTLVMILQ 577 baker's yeast
CAP27378     451 KAMDWaQECEDWHQLMAVAH 470 Caenorhabditis briggsae
NP_001135712 541 LAQTW-KKSEQWATIEQLCs 559 tropical clawed frog
EDO30963     466 ACDGW-RKGEQWGTVEQIIA 484 starlet sea anemone
Q2HAC4       544 ESFQL-RSTTGWQTLHMILQ 562 Chaetomium globosum CBS 148.51
A7EGK5       590 DGYQL-IATPGWANFLAILQ 608 Sclerotinia sclerotiorum 1980 UF-70
P0C7N6       575 EGSAL-QHTGGWATLLTILK 593 Parastagonospora nodorum SN15
Q2URI8       581 DGVQL-ISTPGWATLVTILQ 599 Aspergillus oryzae RIB40
Q1DY54       587 DGVQL-INTPGWATLVTILQ 605 Coccidioides immitis RS
A6R538       571 DGMQL-INTSGWATLVTILQ 589 Histoplasma capsulatum NAm1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap