1YNH


Conserved Protein Domain Family
AstB

?
pfam04996: AstB 
Click on image for an interactive view with Cn3D
Succinylarginine dihydrolase
This enzyme transforms N(2)-succinylglutamate into succinate and glutamate. This is the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway.
Statistics
?
PSSM-Id: 398594
Aligned: 54 rows
Threshold Bit Score: 653.078
Threshold Setting Gi: 118572855
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YNH_B          14 AWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKALADAGFPQAVIPPHERPFIPVLRQLGFSGSD 93  Escherichia coli
Q2Y8M6           3 AYEANFDGLVGPTHNYGGLAVGNIASAESALTNSNPREAALQGLEKMKRLADLGLMQGVLPPQERPAVSVLRKLGFTGED 82  Nitrosospira ...
jgi:Desti_2798   2 TREMNFDGLVGPTHNYAGLSYGNPASMEHALTVSDPRSAVLQGLEKMKLLADLGVPQAVIPPQDRPDIPMLRKLGFKGND 81  Desulfomonile...
Q5ZUT4           3 VYELNMDGLVGQTHHYAGLSSGNIASTNNALSISNPQAAARQGLEKMRQLYNMGLKQGLLPPHQRPNLNLLYQLGFKGTP 82  Legionella pn...
CBJ12088         3 AYELNLDGLVGPTHNYAGLSIGNVASTSNALSVSNPRAAALQGLQKMRLLHEMGLKQGLLPPHQRPNLELLHQLGFSGTP 82  Legionella lo...
WP_013924827     4 AYEVNFDGLVGPTHNYSGLSYGNTASLHNQNLPSNPRAAALQGLEKMKMLHDLGIKQGVFPPHERPHLPTLRVLGFTESE 83  Parachlamydia...
Q9A7W1           4 AFEANCDGLVGPTHSYVGLSPGNLASTRNAGEVSNPRGAALEGLAKMRRLADLGLPQFVLPPHERPAVSLLRQLGFSGPD 83  Caulobacter v...
Q0ANJ0           3 AREANFDGLIGPTHNYGGLSDGNLASARNEGLVSSPREGVLEGLTKMKRLADAGLVQGLLPPHERPFLPLLRRAGFSGSD 82  Maricaulis ma...
Q0C0Q0           4 AVEVNFDGLIGPSHNYGGLSDGNLASSRNAGDVSNPREAAVQGLEKMRFLVRAGLAQGVLPPLPRPNFDILVSAGFTGTD 83  Hyphomonas ne...
WP_012589668     3 AEEINFDGLVGPTHNFGGLSLGNVASIASKGRASNPRAAALQGLAKMRLMMGLGVPQGILPPHERPHVGALRRLGFSGTD 82  Methylocella ...
1YNH_B          94 EQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSADTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVH 173 Escherichia coli
Q2Y8M6          83 ATIIRCAAKVAPGLLRACSSASSMWVANAATVSPSADTEDGKVHLTAANLPSQFHRSIEAPVTSAVLKRVFSNERYFVHH 162 Nitrosospira ...
jgi:Desti_2798  82 SDTISAVARDSKALLAAVYSSSSMWAANAATVSPSADTEDGKVHFTPANLITQFHRSLEPRFTARVLRKIFPDETQFVHH 161 Desulfomonile...
Q5ZUT4          83 SEQINKAYKTAPELLSACYSASSMWTANAATVSASVDTEDNKVHFTAANLISNLHRHQEADFSKKLLEFIFSNSDYFNHH 162 Legionella pn...
CBJ12088        83 SEQINKAYKAAPELLSACYSASSMWTANAATVSPSIDTQDNKIHFTVANLIGNLHRHHEADFSKKIFEIIFSDAHYFHHH 162 Legionella lo...
WP_013924827    84 DRLGEAVFKTSPEIFFNCFSAAAMWTANAATVSPSVDSSDKHVHFTPANLCSKFHRSFEHHTTQKILKTIFSNPIYFIHH 163 Parachlamydia...
Q9A7W1          84 EIVLTSAWRDAPALAAAACSASPMWAANAATVTPSADAADGRVHFTPANLLTNLHRSLEGRQTARSLRRLFADETRFAVH 163 Caulobacter v...
Q0ANJ0          83 SQVIETAWKQAPGLVRKASSASPMWAANAATVSPSADTGDGKLHFTPANLLTTLHRSIEGRQTQRSLSWAFADTERFAVH 162 Maricaulis ma...
Q0C0Q0          84 ANIIEAAGKQAPRLLKAAYSASSMWTANAATVSPSADTGDGLLHFTAANLSTMLHRSLEHPDTTTTLISIFAGDHRFSVH 163 Hyphomonas ne...
WP_012589668    83 GAIVEAAFKADPTLLANLSSASAMWTANAATVSPSADTEDGRVHITPANLAAKLHRSIEAAFSTRLLRAIFADPDHFVVH 162 Methylocella ...
1YNH_B         174 SALPQVALLGDEGAANHNRLGGHYGEPGMQLFVYGREEg--NDT--RPSR-YPARQTREASEAVARLNQVnPQQVIFAQQ 248 Escherichia coli
Q2Y8M6         163 DPLPSNLYFGDEGAANHMRLCPRHGEPGVEIFVFGRSAsrdIP---KPLR-FPARQSLEASEAVARLHQIkRGKELFVQQ 238 Nitrosospira ...
jgi:Desti_2798 162 PPLPCALHYCDEGAANHVRLCSSVGEKGLELFVFGKRPfdtGDI--GPLL-FPARQSFEASRAIARLHGLdRNATIFLKQ 238 Desulfomonile...
Q5ZUT4         163 PLLPKSMGTSDEGAANHNRLCQSHAHSGINLFVYGKKVlgnHQFeqSPIK-YPARQTKEASEAIARNHLLnPERVIFACQ 241 Legionella pn...
CBJ12088       163 PILPRSLITGDEGAANHSRLCQSYGKPGTHLFVYGKKAlgvNNI--GPAK-YPARQTKEASEAIARQHQLmPHQVIFAHQ 239 Legionella lo...
WP_013924827   164 DALPSNSYFSDEGAANHTRFCNGYGNPGIQLFVYGKSSfhpTII--QPLK-FPARQADEASYAIARLHKLyPKHTVFAQQ 240 Parachlamydia...
Q9A7W1         164 DPLPAQPHFADEGAANHVRLCAEHGGPGVNLFVWGREAwshWD-----GR-FPARQTKEAFEAIQRRHG--AARAVFPQQ 235 Caulobacter v...
Q0ANJ0         163 DPLPMQADFADEGAANHVRLCAEQGGPGVEIFVYGRAAgenWA-----GA-YPARQTREACEAVARSHGLdLKRCVFLRQ 236 Maricaulis ma...
Q0C0Q0         164 GALPSHPDFSDEGAANHVRLCAEHGAQGVELFVYGRDAg-------EPTAgFPARQTRLAAESVARAHELdPTRTVFARQ 236 Hyphomonas ne...
WP_012589668   163 DFLPQSGKFGDEGAANHMRLAPNHGAPGVEIFVYGRSAfdeG----APDRgFEPRQALEASQAVARLHGLgEGKALFLQQ 238 Methylocella ...
1YNH_B         249 NPDVIDQGVFHNDVIAVSNRQVLFCHQQAFarqSQLLANLRARVNG-----FMAIEVPATQVSVSDTVSTYLFNSQLLSR 323 Escherichia coli
Q2Y8M6         239 GPAAIDAGAFHNDVLAVANCDVLFYHEAAYrdwEETEARITKACDWp----IHFIRTGEEDVTLAEAVRTYLFNAQLLTL 314 Nitrosospira ...
jgi:Desti_2798 239 SSLAVDSGVFHNDVISVGNQNLFFFHELAFeqqLKSIAAVRDTFVKmydaePIFIEVANRRVPLELAVKTYLFNIQIVTL 318 Desulfomonile...
Q5ZUT4         242 NPLAIDQGVFHNDVISVANEHVFLVHEEAFynqAYVLDQLREKADFp----LVIIQISKEQISVSEAVDTYLFNSQLITL 317 Legionella pn...
CBJ12088       240 NPDAIDLGVFHNDVISVANESVFLVHEQAFveqHSVLNELREKALYp----ITIVEVSHDELSIRDAVETYLFNSQLISL 315 Legionella lo...
WP_013924827   241 SPEAIDAGVFHNDVISVGNQHLFFYHEDAFfrtEEVIQDLQKKVRDiclqdLFLIKVPKKRISLAQAVKSYLFNSQIVTL 320 Parachlamydia...
Q9A7W1         236 GKAAIEGGAFHNDVVCVGTRECLFFHERAFedrATMAREVRAAASGlf--ePAFVEVTEADLPMADLVASYLFNSQLLVV 313 Caulobacter v...
Q0ANJ0         237 SQAAIDAGAFHNDVVCVGTAKTLFFHELAFddkAGALDSIRRAADGlf--ePVFVEVPEAEVPIGDAITSYLFNSQLLEW 314 Maricaulis ma...
Q0C0Q0         237 SRRAIEAGAFHNDVVCVGALDTLFFHEAAFedtAATLEALRRAADGlf--dLKPVMVPQADVPLEDAIRSYLFNSQLLQF 314 Hyphomonas ne...
WP_012589668   239 ARQAVDAGAFHNDVVAVANGPVLFAHEHAFedgEASFEAIPAACSFn----ASLIVAREAEVPLTEAVRSYLFNSQLVSR 314 Methylocella ...
1YNH_B         324 D--DGSMMLVLPQECREHAGVWGYLNELL-AADNPISELKVFDLRESMANGGGPACLRLRVVLTEEERRAV--NPAVMMN 398 Escherichia coli
Q2Y8M6         315 P--GNEMMILAPSECRDSHSARNFLERVVqDAANPIAHVEYVDLRQSMKNGGGPACLRLRVVLTEPELDAVqeNSRVILD 392 Nitrosospira ...
jgi:Desti_2798 319 A--NNDMTVIAPTEIAETPQTADVIDNIIeDSNNPIKSVHYVNIRESMKNGGGPACLRLRVVLSETERQAV--HPNVVLT 394 Desulfomonile...
Q5ZUT4         318 Pd-QKNMILIAPAECQANLKVKTCIDGLVaDPQNPINSVYYLDLKQSMRNGGGPACLRLRVPLNDYELKAM--HQGILID 394 Legionella pn...
CBJ12088       316 Gg-QNSMVLIAPSECQTNLRAHACIERILsESNNPINSVHFLDLKQSMRNGGGPACLRLRIPINQEELLAM--HQGILMN 392 Legionella lo...
WP_013924827   321 E--DQTMTILAPQECQMTPEVELFLRELSqEPQNPINSIRYLDLNQSMQNGGGPACLRLRIVLTEQELAET--HPHVLFT 396 Parachlamydia...
Q9A7W1         314 Pg-EDRLVLLAPVETRDNPRAYAVAESLA-TSNGPIGRVEYVDVRQSMRNGGGPACLRLRVVLTEAELAAA--NPAQRFT 389 Caulobacter v...
Q0ANJ0         315 Pd-EDRLVLIAPKETEETETTRAYCSAMV-AGNGSIGRVEFVDVRQSMRNGGGPACLRLRVVLTPEELAAV--TPSALMN 390 Maricaulis ma...
Q0C0Q0         315 Pg-EDRLVLVAPLEAQETETARRFCDQMV-AGNGPIGRVQYVDVRQSMRNGGGPACLRLRVVMTPDELAEC--HSGVLLD 390 Hyphomonas ne...
WP_012589668   315 PgkPGSMTLTLPEDVKSSPAALAFAQGLVaSGTTPIDELIFVDLRQSMWNGGGPACLRLRIVLTGAERDAM--QGKVLLD 392 Methylocella ...
1YNH_B         399 DTLFNALNDWVDRYYRDRLTAADLADPQLLREGREALDVLSQLLNLGS-VYPFQ 451 Escherichia coli
Q2Y8M6         393 ECLYNDLKAWIEKHYRECLSPTDLGDPALLQESRAALDELTTILGFGS-LYDFQ 445 Nitrosospira multiformis ATCC 25196
jgi:Desti_2798 395 STLYHDLVRWAGAHYRDRLEPEDLADPQLIQETRTALDALTQILGLGS-LYDFQ 447 Desulfomonile tiedjei DSM 6799
Q5ZUT4         395 NDLLDILDKWVLKYYRTELKIPDLADPQLLYECLDALDELTQILKLGS-IYPFQ 447 Legionella pneumophila subsp. pneumophi...
CBJ12088       393 HELLNILEKWVIKHYRTELSANDLADPNLVNEVFYALDELTQILQLGS-IYPFQ 445 Legionella longbeachae NSW150
WP_013924827   397 ETLYQNLSKWIQKHYRDRLTPHELVDPTLIQETRQALDELTQILQLGS-IYSFQ 449 Parachlamydia acanthamoebae
Q9A7W1         390 ADLQDALADWITRRYRDRLSPADLADAKLLTESREALDELTQILGLGDdFYPFQ 443 Caulobacter vibrioides CB15
Q0ANJ0         391 GALYDQLKVWASTHYRDRLAPDELGDPALLTESRAALDALTGILNLGDdFYPFQ 444 Maricaulis maris MCS10
Q0C0Q0         391 EELIDELQAAVRRTYRDRLSPADLADPAFADECRLAREELLSILELEDlv---- 440 Hyphomonas neptunium ATCC 15444
WP_012589668   393 EILLARLEDWVSRHYRDRLTGADLGDPALLEEGRRALDELSGLLGLGS-IYPFQ 445 Methylocella silvestris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap