Conserved Protein Domain Family
CcmD

?
pfam04995: CcmD 
Heme exporter protein D (CcmD)
The CcmD protein is part of a C-type cytochrome biogenesis operon. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation. These proteins contain a predicted transmembrane helix.
Statistics
?
PSSM-Id: 398593
Aligned: 115 rows
Threshold Bit Score: 26.9688
Threshold Setting Gi: 500284571
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014293105           13 GGYGFYVWLSFAVTLLALLGLVVATITTKKRLLREVSQKQARAA 56  Oceanimonas sp. GK1
Q8UC09                  1 MTHAFYIGMSYAATGLVVLCLIAWVVVDGQARKRELKQLEASGV 44  Agrobacterium fabrum str. C58
WP_012652706            1 mTHPFYVYGSYGFAAAMIIAVIVWTWIDGRLRRREMAVLEASGI 44  Agrobacterium
Q2K392                  1 MTHAFYVYASYGFAALVTIAVTLWTWADGRARRRELAALEAAGI 44  Rhizobium etli CFN 42
WP_015917447            1 MKYAFYIGTAYGLTAAAILFMVFWIWLEGRARQKELKALEAAGI 44  Agrobacterium vitis
Q92L52                  2 mSHAAYVVASYAVAAATVAGLILWVLTDGRARRRELQQLEAAGI 45  Sinorhizobium meliloti
jgi:Oant_0109           1 MNHLGYVLASYGITVAALAVTIGWILIDQRIHKNELKRLEAQGV 44  Ochrobactrum anthropi ATCC 49188
CCB67798                4 GPHAAFIWLSYAVVTVTVIGLILWLLADGWKQRAELAALERQGV 47  Hyphomicrobium sp. MC1
WP_013418825            5 GPHAAFIWISYGAAAFCIVALALWAWGDERGQAKRLADLERRGl 48  Rhodomicrobium vannielii
PRJNA229194:W911_01785  4 GPHAAFIWASYGAFVLILMLLICWIWIDGRRQARALADADRRGG 47  Hyphomicrobium nitrativorans NL23
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap