Conserved Protein Domain Family
AKAP95

?
pfam04988: AKAP95 
A-kinase anchoring protein 95 (AKAP95)
A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA.
Statistics
?
PSSM-Id: 398586
Aligned: 11 rows
Threshold Bit Score: 154.865
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ELV13687      507 KEHFKYV--GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDL-DGLIQQiyRDQDLTQE-IAMEHFVKKVEAAHCAACDL 582  Chinese tree ...
OCA42660      279 KEHFRYI--GGRLPKQQADFLEEYVRHKAKKTEERRVVVEDL-SSTIQQiyRDQDLTQG-LGLEHFIKKVEAAHCAACDI 354  tropical claw...
A2CEZ5        286 RETLDYIrrQAKFDDKVISFLHDCMVNKFHKTVSNLHKLKFS-CGRSKD--EWAKIMEG-VTEDDYMRRMEVVYCVACDV 361  zebrafish
XP_015210883  328 KETLDYIqkQAKFDDGVINFLHESMVNKFRKTVSRKLNNNHP-EQTLEE--IHKELMEG-VTEEDYMRKVEVIHCVACRA 403  spotted gar
3_pfamImport    1 QETLDHIqkQTKFDKVVMEFLHECMVNKFKKTSIRKQQTNNQ-TEVVKI--IEKDVMEGnLSYPYHFLNDFSSSVFPSSL 77  
XP_005997758  329 QETMDYIqkQTKFDKVVMEFLHECMVSKNKKTALRKQLSSQV-EQVKTV---QKDVLEG-VTTEDHMSKVETVHCSACST 403  coelacanth
Q28F29        296 QEMLDHIqkQTKFDKPVMEFLHECIVNKFKKTAARRAQSLAN-EAAKAL---EKDVMEG-VTPDDHMMKVETVHCSACSV 370  tropical claw...
Q501K7        120 KEVIKEL--HRTLPKYKVAFIEEYLHRDVKKVVSERRQQHLA-VSK-------TYSLKG-IGQEHFMQQVQAVRCSACDL 188  tropical claw...
CAB43301       81 KETLRFI--STKLPDKTVEFLQEYIVNRNKKIEKRRQELMEK-ETAKPK----PDPFKG-IGQEHFFKKIEAAHCLACDM 152  human
XP_028907613  346 KEHFKFV--GGKLPKQTADFLKEYVNNKTKKTEERRRSIEDLnGVIQQIyk-dQDLTQE-IGPEHFMKKVEAAHCAACDL 421  platypus
XP_026027475  425 KDHFKFL--SSQLSKPTTDFLQEYLQNKFKKTEERVSQLENH-SAAICQvyKEQDLTRE-LGMEHFMRKVEAAHCAACDL 500  eastern happy
ELV13687      583 FIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSIL---NNKLISKKLERYLKGENPF 642  Chinese tree shrew
OCA42660      355 FIPMHFSALQRHLKSPLHNQNRRNTMEQSKKSALAVARSIL---NNKHIGQKLQRYIKGENPF 414  tropical clawed frog
A2CEZ5        362 HIPVLFSSVQQHLHSLTHLKSKVAYKEQLKRDSVVTAKAII---NNDNVKERYEKYMKGEDPF 421  zebrafish
XP_015210883  404 HVPAVLSSVQQHLKSSDHQKNKVLYKEQLKKESVLTATSIL---NNPIVKARYEKYIKGEDPF 463  spotted gar
3_pfamImport   78 LIPS--------LEAYSYLKNKKTPKEQRKQNKYSTSTSFImleSGPTIKARXDSFIHGENPF 132 
XP_005997758  404 YIPAVYSSVQQHLKSADHTKNKQVFNEQMKRECVLTATSIL---NNPIVKERYEKFAKGENPF 463  coelacanth
Q28F29        371 YVPALHSSVQLHLKSADHSKSKLAYKEQIKRESILTATSIL---NNPLVKARYELYLKGENPF 430  tropical clawed frog
Q501K7        189 LLPNVIETLLKHTASESHALNRRMMFGKTVDGSVIVAKKFF---LDKDIIELLDNYMEGNNFI 248  tropical clawed frog
CAB43301      153 LIPAQPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVL---NNRHIVKMLEKYLKGEDPF 212  human
XP_028907613  422 FIPMQQGIIQKHIKTTEHNRNRRLMMDQSKKSSLVVARSIL---NNKLIGIKLERYLKGENPF 481  platypus
XP_026027475  501 FIPMQPHLIQKHIKSPDHNYNRKGMMEQSKRASLSVARSIL---NHKLIGKKLESYLKGENPF 560  eastern happy
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap