Conserved Protein Domain Family
PigN

?
pfam04987: PigN 
Phosphatidylinositolglycan class N (PIG-N)
Phosphatidylinositolglycan class N (PIG-N) is a mammalian homolog of the yeast protein MCD4P and is expressed in the endoplasmic reticulum. PIG-N is essential for glycosylphosphatidylinositol anchor synthesis. Glycosylphosphatidylinositol (GPI)-anchored proteins are cell surface-localized proteins that serve many important cellular functions.
Statistics
?
PSSM-Id: 398585
Aligned: 159 rows
Threshold Bit Score: 239.053
Threshold Setting Gi: 74868984
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPE09923             454 GLRYLQTYDWLFLRALITIGYLGWMAYALT-------TVV-DLHVLDDKTrplpsKTLGNDIF---FSS--VLLA----M 516  Ophios...
XP_001954652         421 ALKYYSTYLHIPVQVTTALALLGWMYFLMI-------KVS-KDSMESKEK-----SRGFVTCAtvtILS--LGLL----V 481  Drosop...
Q9VGM0               417 SLKFYHNYYHIPLVVTTVLALLGWQFYQLVklsqnvmAPH-Y------------------MRRgylTWCtiFLASlgllL 477  fruit fly
XP_002013062         417 CLDYYQDYYHTPLLVAIGASFLGWLFCLVVwlmrefsDQEpQ------------------PKMglqTWAtaLMLLlgsvL 478  Drosop...
XP_001954526         419 CLDYYHSYYHIPLLVSTTLSYVAWFFCLLMqltressHPR-S------------------PRKgylTYPtlIISLaglmV 479  Drosop...
Q9VCV7               413 CMEYYHGYYHLPLLVATTASYLVWFYLLLVrlaresnHPK-S------------------ERKgylTWTtlMMCLgglvL 473  fruit fly
WGS:AAPP:GF16287-PA  413 CIGYYTDYYKFPLLVATTASFFIWSVCMLLqltrlsmEEK-E------------------HREgylKWPtlIAILlgimA 473  Drosop...
XP_002056739         435 CIEYYRVYYRIPLVVACLATYLGWFYYLLA-------KQT-RSMSAP----------KHHWINatnIMLllLEIV----V 492  Drosop...
XP_002000563         414 CLEYYRLYYRIPLVVACMLTYLGWFYYLLAkqgraehEPT----------------------RgwfTIAnlILLMmellV 471  Drosop...
XP_002069936         411 CLEFYKNYYRSGLIAAMIASYLGWLYYLLLklsnkekKPT----------------------GglnSSItrWLMLlgllL 468  Drosop...
EPE09923             517 YASFFASGSSPSYYAYAFFPVFFWKCVFGRRA-----SLaaacnklvsslgkrgaagslasssssrGARVVSLIFKAA-L 590  Ophios...
XP_001954652         482 GELVFLQCSCLMTILCLLLPFGVWCLALAEMP-----C----------------------------EGRSLLEPLTHMgW 528  Drosop...
Q9VGM0               478 GEMVFLQWAPFMTVICLVVPFGVWCMTLAALPqnggwI---------------------------------FEPLKHLrW 524  fruit fly
XP_002013062         479 ECLLFLQRVPCLTSFYLLLPIGIWTMALAERPlhgisI---------------------------------PYPLIHLaW 525  Drosop...
XP_001954526         480 VPVIVLQNVPYLTAFYLVLPLGLLVVALAERPlegqsI---------------------------------ALPVLHLiG 526  Drosop...
Q9VCV7               474 LELMILQRVPHLTAFYLLLPFGILILALAERPcqdrdLM-------------------------------CQFPVLHLvG 522  fruit fly
WGS:AAPP:GF16287-PA  474 LTVVVLQNVPLITGFYLLLPVGLFIMALAERGdqgnlI---------------------------------NVPIAHLaF 520  Drosop...
XP_002056739         493 LLACYLDRVPCCISFYLLVPLPVWMFALQERG-----I----------------------------NSGCVRAPIIQLaW 539  Drosop...
XP_002000563         472 ALTCFLHSVPCSTSFYLLVPVPMWALALREQGlqyscM---------------------------------RAPLIQLaW 518  Drosop...
XP_002069936         469 VSLMLLQKIPGWTAFYLSLPIPMWILALRERPiegrvI---------------------------------VAPITHTiW 515  Drosop...
EPE09923             591 YIAVMESLALGYIYREIFTMLFVLGAFWPVTYGISF--LRK-HFALFAFWFISCLSMSSFTLL-PANKSE---------- 656  Ophios...
XP_001954652         529 IFVPAGGILVALNCPCLFGIIFVCSV---LI-YNRHg-WSY-FSPKFLAWLALLCLLCGFLWSqPAMQILmtt------e 596  Drosop...
Q9VGM0               525 IVGPAAVMIASIYCNCPLSLAYILCV-----GFYNRrgWLH-PSPKFLAWLALVLLLGGFLWSqKGMQILmtt------n 592  fruit fly
XP_002013062         526 TVIPAGLVVATSFMNRHVGLMYAGVA-----VAYNRhgFRR-PTLKFFIWLGTVLLPSGFMIVkQNYSFElm-------- 591  Drosop...
XP_001954526         527 IVVPAGLLILMAFENTHIGILYGLLT-----IFGNTkaFCH-QSWKTVSWFLLVILLTVILMAkQNSWLDwlihpihdlv 600  Drosop...
Q9VCV7               523 IVMPGVLLILMAFHNSHIGLLYLPIV-----CLNNRraFFR-PSLKLIFWLALVFLLSGILLVkQSASLHfitdtigvyi 596  fruit fly
WGS:AAPP:GF16287-PA  521 IMIPAGLLVLMVFTYQHLAVLYTALV-----CLHNRraFRK-PSIKFFVWLSMVVLMGGGLYLqQNPKKKfdvl----si 590  Drosop...
XP_002056739         540 IGGTVVLLIGTYFFKQLISLGFLIVVCANNG--RAF--TRA-PRLRFWLWLALVALLTGFTIKrPDFGRN---------- 604  Drosop...
XP_002000563         519 IGAAVVLFIATYFFKPLIALGYLIVV-----CANNGhaFTRaPRLRFWLWVAVVALLTGFTVKrPDFGCN---------- 583  Drosop...
XP_002069936         516 IGSISSLLVAAFFDRRLLWMGFVLFR-----CACNRqgFAQ-PSVKFVTWFFLVVLLGLFTMVpPSLGRR---------- 579  Drosop...
EPE09923             657 -NIGLIMLGGAVMVVIGIIYlvfeetiisdfaaasksaskavvtnatavakdpiSRALLgAQvgliilsmlv-trssala 734  Ophios...
XP_001954652         597 yRVPLQAASMFMVVLRPFVL----------------------------------KHQFP-GHvwllnvvalvaggvgiyf 641  Drosop...
Q9VGM0               593 yRVVLQAISMLVVIVRPCVLnenhkwkvwvingg-----------------------------------ilfvaaigifl 637  fruit fly
XP_002013062         592 pSEYVLGFSMCLAVLLPWILghkhqmrvwlinsf-----------------------------------illigiygiyl 636  Drosop...
XP_001954526         601 rNSHVLFVSMVLSLLRPVVMshqlsirvwtvnla-----------------------------------allfagygvyq 645  Drosop...
Q9VCV7               597 gNSHVVYFSMILSIIRPLILghqhstrvwivnma-----------------------------------allvtaygiyq 641  fruit fly
WGS:AAPP:GF16287-PA  591 qNNYLLHMGMLLALVRPVFLghhheppvwifnti-----------------------------------tlmlgaygayq 635  Drosop...
XP_002056739         605 -SPYLLCLSMLVTMLRPLLLs---------------------------------ERHAC--Rvwlingaalllgaylvhq 648  Drosop...
XP_002000563         584 -SIVLLFLSMLVTILRPLLMnerhvcrvwlsngs-----------------------------------alllatylaye 627  Drosop...
XP_002069936         580 -DTKLLSFSMLFALLRPLVLrehhkmriwiingc-----------------------------------tlvmgayltyr 623  Drosop...
EPE09923             735 irNKTGLPRGNQIVGLITLFSSFTvMPLAHRSRPsgnyLNRLMVVFLTFAPTFVILTISYEGLFYVAFSAVLIAWVRIEH 814  Ophios...
XP_001954652         642 heIGKTVPIYILAGSWIHLIYAILsSAYCVNSGP----RNRWEIICFNLLTVHALLSDSYSSLFVQALVTEYQMGGEVHE 717  Drosop...
Q9VGM0               638 keMGKPVPLYLFAANWAYLIYAFAsVPCSSRTTP----QSRLELIRFNLLTLHVLLSDSYVSLFAQGLIIEYQMGLEVHE 713  fruit fly
XP_002013062         637 seNNLEVPLYLQVAFWAFLGYAFLsVPYSNADTP----ESRLHLISFNLIAVHALLSLSTGSLFNQMMITEFLLSHEIHS 712  Drosop...
XP_001954526         646 wdAEKDVCFYVYAVCWTYLAYSFLsIPYSGVKHP----KRRVELIIFNMLTLHIMLTTSIESIVAQIMITEFSLNMDLLQ 721  Drosop...
Q9VCV7               642 wdADQPVCTYVYAACWSYLLFAFLsIPYSGTKDL----RRRLELIIFNMLTVHIMLTTSIGSLFVQIMVTEFVLGLELYE 717  fruit fly
WGS:AAPP:GF16287-PA  636 feANTPVWNYVKATCWSFLVYAFLsIRYFSDKLPt--aKGRLQLITLNMITLICLLSTSWGALLIQILVTEFVFGLELYE 713  Drosop...
XP_002056739         649 rlCKKELSPVLQGTAWGYVCYALIsIPYSDTKTP----RHRVQLILFNLSTIYTLMSLSYESMFMQLLCTEFLLGVQVHE 724  Drosop...
XP_002000563         628 rlSKNEINCVLQGAAWFYVLYAFIsIPYSNTKTP----RRRVQLILFNLSTVYTLLSVSYESIFMQLLCTEFLLGMQVDT 703  Drosop...
XP_002069936         624 knDNVVVLMVFRQLAIANLAYGFIcIPFSSSTTA----QCRLNLIWFNLSTIYTLLSTSFESFFMQLLLMECLMSRKLNG 699  Drosop...
EPE09923             815 AVFVhtqgqipeeaeqpqiqaqpapptpkpskkkqdkaakanggsngkptngATPTSKPKATIPAAPADTASPRSLTLAD 894  Ophios...
XP_001954652         718 ESKQ------------------------------------------------LNEVEQADEEMQPGKETPMTSSMHLHMS 749  Drosop...
Q9VGM0               714 kfk----------------------------------------------eadEDVK-----ILTSSKHLQ--------MC 734  fruit fly
XP_002013062         713 einqaknnailet--------------------------depesdsnnenasETTQKNEENPSTPLEHLK--------LS 758  Drosop...
XP_001954526         722 erklqkeikvredeve---------------------eiehigdnqevseelELDRVIP--SKSPLKHLK--------ES 770  Drosop...
Q9VCV7               718 esfsyanlkda------------------------------ianqqqnnqglEESRNES--PNNPLEHVR--------QS 757  fruit fly
WGS:AAPP:GF16287-PA  714 eskqvkddgkv------------------------------vadkeeeeeeqEEIAVEEELSYNPEGYLK--------QS 755  Drosop...
XP_002056739         725 DYKQ-------------------------------------------------SAVEDSEDDDEQTPDKSLTPEGHINRS 755  Drosop...
XP_002000563         704 gkknltd---------------------------------------sedsegVEDEAKPDKSLSSEDHIN--------KI 736  Drosop...
XP_002069936         700 -------------------------------------------------------------------EINLYKGCPLKNS 712  Drosop...
EPE09923             895 ARIALFFFVLLQSAFFSASNVASVSSFSLDSVQRLIPVFDPFSQGALLIVKLLVPFALISANLGMLNVRLGVAPSALFMV 974  Ophios...
XP_001954652         750 YRFAVSILLYFYVSLLGSGHWIGGFTYLGNTARLYLPEPYSVPMALLVLIHLLIPVFVFLSSLRAKSSFARLGTRSIITC 829  Drosop...
Q9VGM0               735 YRFAVSILLYFYASLFGTGHWVGGFTYLANSARLFLPDSSSGLVPLLVLIHLLIPSIVIMASVVALSSFGRQQIRTIFSS 814  fruit fly
XP_002013062         759 YHYAAFILFYFYLSFFGSGHWLFSFAFKPTTSRLLISNYSPFIMTALIILKILIPSIIVISGVYTFSAYARKKSRAVFIC 838  Drosop...
XP_001954526         771 YRYAIIFLVYFYVSFFGTGHWFFNFTFKATVSRLFLSSFSLHLSVALILLKIFIPSIIIMSSVYALVSFGRKNARSIMIC 850  Drosop...
Q9VCV7               758 YRYAALILLYLYISFFGTGHWFFNFTFKPMTSRLFFPQFHLHMLVAFILLKIFIPSIIVMSSIYALVSFGRKNVRSIFIC 837  fruit fly
WGS:AAPP:GF16287-PA  756 YRYAFAILMYFYVAFVAAGHWVYGFQFVPTTARLFYSHISMALSGSFIILKIGLPAVIVIATLYALVPFARHNSRSIITC 835  Drosop...
XP_002056739         756 YRYAVLILIYAYFSMIGSGILPNINSLDASVARIFVSECSIILIGFIYVLKLMIPIIIIMSSMYAFCAHARQNLCGIFIC 835  Drosop...
XP_002000563         737 YRYAVLILVYAYFSMIGTGNLLNISAFDTSFAHIFVSDCSTVLIFLLYMLKVMIPLIIIMSSLCAFRAYVRHNLCGIFIC 816  Drosop...
XP_002069936         713 YRYASFILLYAYLSFFGIGNLSSISSFDPNTGRLFMAGDTIIFTGFLVLLKLSIPSIVIIASMYLTCSFVRHNVREIFIS 792  Drosop...
EPE09923             975 VMAMSDVLTLYFFWVVKDEGS 995  Ophiostoma piceae UAMH 11346
XP_001954652         830 LVLICNAVVLFYVVfidhrsd 850  Drosophila ananassae
Q9VGM0               815 LMLICNAVVLFFVVFvphnay 835  fruit fly
XP_002013062         839 MFLISDVMCFYFCFYVQNQGS 859  Drosophila persimilis
XP_001954526         851 VFLVNDAMSLYFCFYVENRGS 871  Drosophila ananassae
Q9VCV7               838 LFLMNDAMSLYFCYFVINRGS 858  fruit fly
WGS:AAPP:GF16287-PA  836 MLLISNVMSMYFCYFVGNEGS 856  Drosophila ananassae
XP_002056739         836 IFLICDVLCLYFFFFVRNSGS 856  Drosophila virilis
XP_002000563         817 LFLICDVLCLYFFFFVRNSGS 837  Drosophila mojavensis
XP_002069936         793 LFLMADTMSLYFLLQMRSEGS 813  Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap