1U60,2OSU


Conserved Protein Domain Family
Glutaminase

?
pfam04960: Glutaminase 
Click on image for an interactive view with Cn3D
Glutaminase
This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2.
Statistics
?
PSSM-Id: 398563
Aligned: 287 rows
Threshold Bit Score: 296.204
Threshold Setting Gi: 489763306
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U60_B         24 GQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDvGPQAVQDKIGADPTGLPFNSVIa 103 Escherichia coli
SDU:GNIT_0245  19 GIVASYIPQLAKIDPNQFAISVALPNGEIYSAGCAQTTFSIQSVSKVFTLTLALGK-LGESIWSRVGREPSGDPFNSIVq 97  Glaciecola nit...
Q15U72         19 GKVANYIPQLACVDPNQFALTVVTQEGEVFSAGCAQTLFSIQSISKVFTLTMALGK-LGDALWAQVGREPSGDPFNSIVq 97  Pseudoalteromo...
WP_014879519   23 GEVASYIPELGEVRPDQFAISVATADGGLFSAGDFQTRFSAQSITKVFTLAIALGR-AGDQLWHRVGREPSGTAFNSIVq 101 Phaeobacter
Q165W6         20 GETAQYIPELATVDPKQFAISVCLADGRMISAGSATKPFSIQSISKVFALVAALGR-VGNQLWSRTGREPSGTSFDSMVl 98  Roseobacter de...
WP_025295437   22 GKVADYIPALARVDIGRFGIAVILADGTVHVGGDADIPFSIQSVSKVFMLTIALGR-VGDALWRRVGREPSGSAFNSIVq 100 Sphingomonas s...
Q5FP94         22 GTVANYIPPLARVDLNRFGMAVVGMDGETHTVGDAEVPFSVQSVSKVFSLSMALNA-MGDELWGRVRQEPSGSAFNSIVq 100 Gluconobacter ...
CCA93838       26 GKVADYIAPLACVPLEKFGLAVVMADGTVHCAGDSDEPFSIQSISKVFALTLVLGA-VGDQLWKRVGREPSGSAFNSIVq 104 Novosphingobiu...
BAK64882       23 GAPARYIPGLAGISTDRFGMAVVTADGATAMGGDAEMPFSIQSISKVFALTMALGK-IGDQLWRRVGREPSGNAFNSIVq 101 Sphingobium sp...
WP_007688815   21 GTVASYIPELAKVDPGQFGIAVATADGRLIEGGDSATGFSIQSISKVFALTLALGK-VGDQLWQRVGREPSGNAFNSIVq 99  Sphingomonadaceae
1U60_B        104 LELHGGKPLSPLVNAGAIATTS-LINAENVEQRWQRILHIQQQLAGE--QVALSDEVNQSEQTTNFHNRAIAWLLYSAGY 180 Escherichia coli
SDU:GNIT_0245  98 LEHEHGKPRNPFINAGAIAVADaIMQGHQPKETLAEIVQFIRFLANDe-SIVIDEKVARSEVETGTRNASLAYFMASFGL 176 Glaciecola nit...
Q15U72         98 LEHEGGIPRNPFINAGAIAVADaIMGHNEPKETLAEILHFVRFVANDd-SISIDEKVAQSEMMTGSRNASLAHFMASFER 176 Pseudoalteromo...
WP_014879519  102 LEHEQGRPRNPFVNAGAIVTTDeVLAGREPREALAEFLGFVRAAAEDd-DIHINADVARSETAHGHRNAAHAHFLASFGN 180 Phaeobacter
Q165W6         99 LERENGRPRNPFINAGAIVTTDaLLCGRPPKQALAEILGLVRQMSGSn-GIFINDAVAASEQRTGSRNKALAYYLQSHGN 177 Roseobacter de...
WP_025295437  101 LESEHGIPRNPFINAGAIVVSDiVLQGSDVRSAAGDLLRFLRFLADDd-SIVIDREVAESEAQTGFRNYALANYIKAFGN 179 Sphingomonas s...
Q5FP94        101 LENEHGIPRNPFINAGAIVIADiLVSRYGRENAQTRLLEFLRPLVSDpsSIDIDTDVARQERETGFRNMALANYMRTFGN 180 Gluconobacter ...
CCA93838      105 LETEHGIPRNPFINAGAIVVCDvLLGGLQPREAIGQMLRFVRELAGDd-TIAIDETVARAEQETGFRNMALANYMRAFGN 183 Novosphingobiu...
BAK64882      102 LEAEHGIPRNPFINAGAIVVADvNLSGHMPRESIGELLRFVRFLADDe-TIVVDEAIARGEAETGYRNIALANYMRAFGN 180 Sphingobium sp...
WP_007688815  100 LEHEQGIPRNPFINAGAVVVADvNLGGHQPRVAIGEMLRFVRYLAGDd-GIAINETVAASETATGFRNMALAHYMRAFGN 178 Sphingomonadaceae
1U60_B        181 LYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPlTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKS 260 Escherichia coli
SDU:GNIT_0245 177 FENSVDAVLGTYFHHCSIAMNTHQLATAGLFLANNGINPsTGYAVVSPQRAKRINALMLTCGHYDGSGEFAFRVGLPGKS 256 Glaciecola nit...
Q15U72        177 LENPVDKVLGTYFHHCSISMTTEQLARAGMFLVSNGTNHcTGMRVVPEHRARRINSLMLMCGHYDGSGEFAYRVGLPGKS 256 Pseudoalteromo...
WP_014879519  181 LKNPPEKVLGTYFHHCATEMTTQQLAKAGRFLIGTGSYP----RMVSLDRVRRLNALMLTCGHYDGSGEFAYRVGLPAKS 256 Phaeobacter
Q165W6        178 LVNDPDLTLGTYFHQCAIEMTTEQLAMAGRSLAGLEGAP----RVISLKHVRRVNALMMTCGHYNGSGDFAFRVGLPGKS 253 Roseobacter de...
WP_025295437  180 LRNPVEDTLQLYFNQCGIAMSCRQLAAAGRYLMLDGRHPaTGQQVVTARRARRINAVMLTCGHYDGSGEFAYRVGIPGKS 259 Sphingomonas s...
Q5FP94        181 IRNVVEDTLDFYFHQCALTMSCHQLAQVGTCLMTGGRNPlTGERIMSERNAQTILALMMMCGHYDGSGAFAIRVGLPGKS 260 Gluconobacter ...
CCA93838      184 IHAPVDLVLGTYFHFCALAMSCRQLALAGRFLMADGRNPvSGFSVVTPRRARRINALMMSCGHYDNSGDFAYRIGLPGKS 263 Novosphingobiu...
BAK64882      181 IHHSVELVLGCYFHQCAIAMSCLQLAMAGRFLMLDGMQPgAG-RVISPRRARRINALMLTCGHYDASGDFAFRIGMPGKS 259 Sphingobium sp...
WP_007688815  179 IRHPVDLVLGTYFHQCAIEMSCRQLALAGRYLMLDGRHPeGG-RVVSSSRAKRINALMLTCGHYDASGDFAFRVGIPGKS 257 Sphingomonadaceae
1U60_B        261 GVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYN 306 Escherichia coli
SDU:GNIT_0245 257 GVGGGILAIAPGKASIAVWSPGLDVIGNSKLGTEALELFASKTGWS 302 Glaciecola nitratireducens FR1064
Q15U72        257 GVGGGILAIAPGKASIAVWSPGLDKIGNSKLGTEALEMLVQETGWS 302 Pseudoalteromonas atlantica T6c
WP_014879519  257 GVGGGILGVVPGQASIAVWSPGLNRNGNSKLGTEAMEQLAREMDWS 302 Phaeobacter
Q165W6        254 GVGGGILIIAPKVASIAIWSPGLNHYGNSYAGTRAAEMLSKATNWS 299 Roseobacter denitrificans OCh 114
WP_025295437  260 GVGGGILAVVPGEASIAVWSPGLNERGNSQLGSLALERLSEATGWS 305 Sphingomonas sanxanigenens
Q5FP94        261 GVGGGILAIAPGVASIAVWSPGLNAQGNSLLGTRALERLVQHTGWS 306 Gluconobacter oxydans 621H
CCA93838      264 GVGGGILAVVPGIASIAVWSPGLNRSGNSHLGQLALERLVQKTGWS 309 Novosphingobium sp. PP1Y
BAK64882      260 GVGGGILAVVPGKASIAVWSPGLNASGNSQLGTLALERLAEATGWS 305 Sphingobium sp. SYK-6
WP_007688815  258 GVGGGILAIVPGRASIAVWSPGLNENGNSQLGTLALEELARRTGWS 303 Sphingomonadaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap