Conserved Protein Domain Family
Peptidase_M55

?
pfam04951: Peptidase_M55 
D-aminopeptidase
Bacillus subtilis DppA is a binuclear zinc-dependent, D-specific aminopeptidase. The structure reveals that DppA is a new example of a 'self-compartmentalising protease', a family of proteolytic complexes. Proteasomes are the most extensively studied representatives of this family. The DppA enzyme is composed of identical 30 kDa subunits organized in a decamer with 52 point-group symmetry. A 20 A wide channel runs through the complex, giving access to a central chamber holding the active sites. The structure shows DppA to be a prototype of a new family of metalloaminopeptidases characterized by the SXDXEG key sequence. The only known substrates are D-ala-D-ala and D-ala-gly-gly.
Statistics
?
PSSM-Id: 398555
Aligned: 123 rows
Threshold Bit Score: 258.16
Threshold Setting Gi: 523988058
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCX73354         1 MKFYILCDIEGVASLTCWDEARSANACYAPMAREMALEAAAAARGLFSGGAD--EVVIEDMHGDGCNIDCALLPRDARLL 78  Firmicutes ba...
WP_020952940     1 MKVFISADMEGTAGIAHWDEADRNHVDYEQFRVLMTAEVVAACEGARAAG-Ad-EVLIKDAHESGRNLLVDRLPAYARIV 78  Paracoccus am...
Q18BR2           1 MKLYLSADIEGTCGIVNWDETKLECEFSQHYRTQMSKEITAACDGATQSG-Vh-EILVKDAHDSGRNINPNILPENVKIL 78  Clostridioide...
CCX66899         1 MKLFISSDIEGTCGINDWDETEIGKPGYDRFALQMSREVSAACSGALETGKVe-DILVKDAHDSARNIIGDELPEGVHLI 79  Firmicutes ba...
CCX65583         1 MNLFISSDIEGTCGICDWSEISEGGSGYERFAEQMSREAAAACEGA---G-PdaEIMVRDGHGSARNIIPALLPDNAVLM 76  Firmicutes ba...
ENZ46420         1 MKVYISVDFEGVAGSTSWSSTNLGDLEHGPMAREMTLEAAAACRGALAAG-At-EIYIKDAHESGRNMDISLLPKEAKII 78  [Clostridium]...
Q1GB35           1 M--------EGCAGVTSWEQTHYGHKGYDLALKEMTRETVAAVKACQQAG-Y--QVTVKDGHEDGINLDPALLPAGTELI 69  Lactobacillus...
CDB02884         1 MKVFISADIEGVTGVTSWCETESGGQGYEAAARQMTLEVSAACEAAIEMG-F--DVVVKDGHGNARNIDMWGLPKGVSLI 77  Firmicutes ba...
jgi:Clole_1806   1 MRVYISADLEGITGVSKWEETHKGGHYYDLYREQMTREVVAACEGAIEAG-Ae-YIMVKDAHEDGKNLIHSMLPRGVKVI 78  Cellulosilyti...
CDA91571         1 MKFFISADLEGTNGVVSPGEIIPGEPGYEAARILMTEEVNAAVRGLFDAGAD--EVLVCDSHEVAQNIRVDLLDERAFLL 78  Firmicutes ba...
CCX73354        79 RG-ITHDIVGLTGIfDESYDGMLMVGFHDAASAPGNPTSHTMVSSRIFRLTVNGALWGEFEMYAHAAAYRGVPTLFASGD 157 Firmicutes ba...
WP_020952940    79 RGwSGHPDSMMFGL-DPSFDAAIYTGYHAKAGAESNPLAHTSTLRISR-FLLNGEVASELTVNALAAARHGVRSAFIAGD 156 Paracoccus am...
Q18BR2          79 RGwTKDPLVMMAGI-DESFDACIFTGYHSGATCNGNPLSHTMDIDYDY-FKINDEIASEFTINAYIAAYYNVPVAFLSGD 156 Clostridioide...
CCX66899        80 RGwVTNPGSMMSGV-RQ-CDAAAMTGYHSGAYSIGNNLSHTMNLRNQY-IEVNGKYASEFMLNSMFAAYYGIPTIFVSGD 156 Firmicutes ba...
CCX65583        77 RGwEKSPDGMMAGI-STGFDACAMVGYHAHAYSTGNPLAHTSEPNIQK-LLLNGEYCSEFRYNAYFAAYYGVPTIFISGD 154 Firmicutes ba...
ENZ46420        79 LGwKYSPDSMVCGL-DQSFDALMFVGYHSPAGTNGSPLAHTMNRKTNY-IKFNGKLASEFLMHAYVGASLGVPSVFISGD 156 [Clostridium]...
Q1GB35          70 QGwDSSPEEMMAGI-SADYAGAIHIGSHSPAGSSETPLDHTVEHGWYSWVKLNGELASEFTFNSLCAAQYGVPSLFLAGD 148 Lactobacillus...
CDB02884        78 RGwRCSPEGMMGGL-DSSFDAVIYIGYHSPEGMNTNPLAHTTEHEWFNWIKINDRLASEFSMNALYAANLGIPSVFLSGD 156 Firmicutes ba...
jgi:Clole_1806  79 SGwSNHPYCMVEGL-DESFDAVIFIGYHSGASSNGSPLAHTLLPDVIKNVTINGEDADEFLIHAYAAYMLGVPIVAVSGD 157 Cellulosilyti...
CDA91571        79 RG-DCRPDSMVHSI-DSSYDGLLLLGHHAMFGTQNAVLDHTYDQYLIREMKVNGTAYGEVGINALYAAEQGVPFIMTSGD 156 Firmicutes ba...
CCX73354       158 EGMCAAAARTVPGLLTVPTKSGHG-YGVLTKTPELVCEEIEGMMAEAVAAEGMmaeagaaekpAAPPVLP-----DHFHV 231 Firmicutes ba...
WP_020952940   157 AEICADAQAMIPGIHSFATLEGFG-RASISVAPVRAQEAIRAGVEAALREGV-----------GGLPQIE-----GPFEV 219 Paracoccus am...
Q18BR2         157 EMLCESAKKLNPNIVTVPVSKGIG-NGSISIHPNLALKKIEKGVKKALSGDLS----------RHLIKLP-----DKFKI 220 Clostridioide...
CCX66899       157 KALCEEAKELIPEITTVPVFEGWG-TSTISIHPKTAIRLIHDGMKEAISKDPR----------TCLMTLT-----EHFHV 220 Firmicutes ba...
CCX65583       155 ADICKEAKELIPSITAVPVLRSHG-GASISIQPERALQLIREGMARAMAGDFA----------ACLPKLP-----EHFCA 218 Firmicutes ba...
ENZ46420       157 KNLCSHVHEYDPGITAVAVKEGMG-AATVNLAPEMAQELIEEGAKNALLTKD-----------ACHLEVP-----ETIVM 219 [Clostridium]...
Q1GB35         149 AGICRRAEDFCPGIVTCATKKGVG-SATVNKSPQEVAAGIATGIKEALAGPG---------------GLPll--aDEYLL 210 Lactobacillus...
CDB02884       157 RGICDHAREYCSDIVTVAVKEGVG-NSSWNMHPEDSIRAIKSGVKEALRDVR-----------------PvclerQEYKM 218 Firmicutes ba...
jgi:Clole_1806 158 GDLMRSVRSFNPQIKTIAVQEGFG-GAVVSIHPDLAIERIRKGVKKGLEALE-----------EYTFEKP-----EEYEL 220 Cellulosilyti...
CDA91571       157 DALEKEAQAFCAEVEIAVVKYAQGrYSAKCLPRKAGLDLIYDKAKKAAENAKN----------VACAKIP-----EEITM 221 Firmicutes ba...
CCX73354       232 EVTYIHHYDAYGCSHYPGASLISPTTLAFDADDYGDVLRFFY 273 Firmicutes bacterium CAG:83
WP_020952940   220 VIEFVNPTDAYRVSWFPGARAHGPRAVAFAATEFFEIQRALR 261 Paracoccus aminophilus
Q18BR2         221 EIKFREHYKAFKASFYPNMKKIDSQTVLFETEDYYEFLRMLL 262 Clostridioides difficile 630
CCX66899       221 EIEFKDMEKAQRGSYYPGVTRVGSKRIAFDSEDYYEVTRTLY 262 Firmicutes bacterium CAG:791
CCX65583       219 DIEYKEYQDAEKFSYYPGAKRLDAKTVRFEADDYYEVKRFFM 260 Firmicutes bacterium CAG:791
ENZ46420       220 EINFKDHFQALRASYYPGMVMTDDFTVSYTARSINELMTARm 261 [Clostridium] bolteae 90A9
Q1GB35         211 EFCFSSAGRARAASFYPGAERAGERIVSYRAKSIMELLTAkm 252 Lactobacillus delbrueckii subsp. bulgaricus ATCC 11...
CDB02884       219 DIFFKEHQRARAASWYPKAELTGSNSVRYTAEDVDELMIakm 260 Firmicutes bacterium CAG:145
jgi:Clole_1806 221 IIEFKKHADAYKFSFYPNVEQIGEYTIRYVSNNYMHLLVLLL 262 Cellulosilyticum lentocellum DSM 5427
CDA91571       222 EITFQQTVMADGAERVKGIVRKGPMTVAYKCASMKEYMEMRQ 263 Firmicutes bacterium CAG:238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap