Conserved Protein Domain Family
Transcrip_act

?
pfam04949: Transcrip_act 
Transcriptional activator
This family of proteins may act as a transcriptional activator. It plays a role in stress response in plants.
Statistics
?
PSSM-Id: 398553
Aligned: 20 rows
Threshold Bit Score: 186.115
Threshold Setting Gi: 565391463
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6H6P9        16 CVRGGGGGG-GGGGGe---ED-GSsewDQSSSRSALSLFKEKEEEIERKKLEVREKVFSMLGRVEEETKRLAFIRQELEV 90  Japanese rice
ERN13145      15 vRNSASF---RESPK----ED-RE---EEEGARSALIAFRAKEEQIERKKIEVREKVHAQLGRVEEETKRLAEIREELEA 83  Amborella trich...
XP_006361442   8 vsssGRTSTsEDNNNi---ND-NE---DQEMTKLALASFQAREEQIERKKMEVKGKVESQLTRAEEETRRLVRVWEELEV 80  potato
XP_002523043   1 mrNMGSMGS-GGKLSm---EE-NE---EDEISRFDISSFQAREEEIERKKMEVREKVELQLGRAEEETKRLTQIWEELES 72  castor bean
ACU24394      14 MKNLGSIGS-SGRLSa---EE-YE---DEEISKLAISTFQSKEEEIERKKTEVREKVELQLGRAEEETRRLAHIWEELEV 85  soybean
XP_002315451   2 knMGSNIGS-SGRLSt---EEiNE---EEEIPRLDISKFQAREEEIERKKMEVREKVELQLGRAEEETRRLTHIWEELEV 74  black cottonwood
XP_010658727  35 qKTKNNLSS-SGRLAtmmmME-DE---EEDVTRSAISTLQSREEEIERKKMEVRQKVELQLSRAEEETRRLAQIWEELEV 109 wine grape
XP_002283313  14 EQNSGSLSF-NGS------LS-KE---EEEMSKSALSTFRAKEEEIEKKKLEVREKVQVQLGRVEEETRRLATIREELEA 82  wine grape
XP_006339121  18 GQISGSFSF-NGT------LS-KE---DEEMSRSALSTFKAKEEEIEKRKMEVRERVQAQLGRVEEETRRLAIIREELET 86  potato
Q3EBM1        41 VLHTGSLSF-SSH------MS-RE---DEEMTRSALSAFRAKEDEIEKRRMEVRERIQAQLGRVEQETKRLSTIREELES 109 thale cress
Q6H6P9        91 MSDPTRREVETIRKRIDKVNRQLKPLGKNCLKKEKEYKACLEAYNEKSNEKATLVNRLMELVGESEQLRMKKLEELNKTV 170 Japanese rice
ERN13145      84 LADPMRKDVAGLRKRIDAVNKELKPLGYSCQRKEREYREAVEAFNERNKEKSQLIAKLMELVSESERLRMKKLEELSKHI 163 Amborella trich...
XP_006361442  81 LTDPMRKEVAMVRKKIDVINREIKSLGQSCQKKEKEYREVLEAFNEKNNEKTQLTSTLVELVKESEKLRMGKLEELSKVL 160 potato
XP_002523043  73 LADPTRKEVAMVRKKIDVANRELKPLGQSCQKKEKEYKEALEAYNEKNKEKAQLVTTLMELLTESERLRMKKLEELSKNI 152 castor bean
ACU24394      86 LDDPMRKEVAMVRKKIDLANKDLKPLGLNFQKKEKEYKEALEAFNEKNKEKAHLVATLVEMLTESERLRMKKLEELCKII 165 soybean
XP_002315451  75 LADPLRKDVAIARKKIDMANKELKPLGQSCQKKEKEYKEALEAFNEKNREKAQLVATLMELLTESEKQRMKKLEELNKIM 154 black cottonwood
XP_010658727 110 LADPLRKEVAVVRKKIDMANRDIKPLGQSCQKKEKEYKEALEAFNEKNREKAQLVTTLMELLSESEKLRMKKLEDLSKHV 189 wine grape
XP_002283313  83 LADPMRKEVAQVRKKIDSVNRDLKPLGQSCQKKEKEYKDALEAYNEKNKEKVQLISKLMELVSESERLRMKKLEELSKNI 162 wine grape
XP_006339121  87 LADPMKKDVSTVRKRIDVVNKELKPLGQTCQKKEKEYKEALEAFNEKHKEKVQLISRLMELVGESEKMRLKKLEELSKSI 166 potato
Q3EBM1       110 MADPMRKEVSVVRKKIDSVNKELKPLGSTVQKKEREYKEALDTFNEKNREKVQLITKLMELVGESEKLRMIKLEELSKSI 189 thale cress
Q6H6P9       171 ES 172 Japanese rice
ERN13145     164 DS 165 Amborella trichopoda
XP_006361442 161 np 162 potato
XP_002523043 153 p- 153 castor bean
ACU24394     166 ES 167 soybean
XP_002315451 155 ES 156 black cottonwood
XP_010658727 190 DS 191 wine grape
XP_002283313 163 DS 164 wine grape
XP_006339121 167 ET 168 potato
Q3EBM1       190 ET 191 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap