Conserved Protein Domain Family
Wzy_C

?
pfam04932: Wzy_C 
O-Antigen ligase
This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.
Statistics
?
PSSM-Id: 398545
Aligned: 77 rows
Threshold Bit Score: 36.2364
Threshold Setting Gi: 122681860
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDO56990     231 FVLFLGGMAVIAANSDVAYIGI--GVPMVVLLLAGIRNRVktyddrmvigqnstcdPFLGWLI-GYAGIVLGYTVMAflt 307 Clostridium sp....
Q9AQJ1       174 GALLSTIILPIGSGSRAGIIVVllQVIILLLNTIVIKRQT------------------IRFFL-YLVPILILLLVIL--- 231 Streptococcus a...
WP_011721620 222 LLNIYILLTIAYTYSRTGYIVI--AIEFIIFNVLYLKQHSksi----------ykkIYATHSI-ILISIFIIILVIY--- 285 Clostridium novyi
Q9X4C1       176 FYAIMFIFFLYMTNSRGSILAI--MAAFGYSLIKFKKPFL---------------------VF-TIFLLIQFFIVQE--- 228 Escherichia coli
Q01XB1       184 AAGIAIGASLVAGYTRSMWMGA--ALGGGYLVWMRQKRWL------------------LLAPL-PVL-LLLWANPFG--- 238 Candidatus Soli...
KQB91782     200 AVYAIYVINLVLTYTRAAWVAM--LGGLVLVILLMPKTFFknv-----------irPHILVSF-AVLLTIVYFMPDV--- 262 Geobacillus sp....
ABS75602     261 LFAICALYLIILTGSRASLLGI--CAGAAVYVFILLPSLLk---------------KLALYAA-GAGAALCAVLFAGr-- 320 Bacillus veleze...
Q4K127       198 HNILIALIILFLSLKRIVFLSV--LIIIPVFLVIYWYDKK----------------VSKLGKErKILSLLNIFSLIF--- 256 Streptococcus p...
Q4JZ62       213 FTTWILIITIMTTTSTTGVY----IIGLIFLYVLFSKTSG----------------VKRYVSSlFILATICCFSILW--- 269 Streptococcus p...
Q97ER0       210 LYKFLLIVCIMLTLSRT-AIGI--LLLYIIIKIIRSKNAK----------------SVVRFGI-ISLMVVLIGITLW--- 266 Clostridium ace...
EDO56990     308 tgtgkgydkltglaklvdhrliltiesivlvIGSLLYGWGSRKKADCvvaqkkglrsvkdkkqastmgcwkvifwsvvgi 387 Clostridium sp....
Q9AQJ1       232 -------------------------------RFDNLVSIYNRII------------------------------------ 244 Streptococcus a...
WP_011721620 286 -------------------------------KLDLSNNLISLL------------------------------------- 297 Clostridium novyi
Q9X4C1       229 -------------------------------TYPTWVSMGKIMSENAnytvss--------------------------- 250 Escherichia coli
Q01XB1       239 -------------------------------VGERMRSVYKP-------------------------------------- 249 Candidatus Soli...
KQB91782     263 -------------------------------QSRTYSAVYAMEKIISrhlhsdstnhvdgns------------------ 293 Geobacillus sp....
ABS75602     321 -------------------------------ITNAVLNLFSAPQAMPg-------------------------------- 337 Bacillus veleze...
Q4K127       257 -------------------------------ITGIFFYVYSVKSDFIyt------------------------------- 274 Streptococcus p...
Q4JZ62           --------------------------------------------------------------------------------     Streptococcus p...
Q97ER0       267 -------------------------------IAISKYNVYFF-------------------------------------- 277 Clostridium ace...
EDO56990     388 liltafvtvvtgvgnqweifTFDDEWGN------YRGYV-WNRLFRIYQ-DLPFvnkvFGTGnes-------iytLMSAR 452 Clostridium sp....
Q9AQJ1       245 --------------------NLRSGSSE------SRFSL-YKDTVHSVItDSLF----LGKG------------------ 275 Streptococcus a...
WP_011721620 298 --------------------DKNNISNI------TRFTS-QKISLDLGI-NNFV----FGVGlgqyaf-yfkdiiKNYPI 344 Clostridium novyi
Q9X4C1       251 --------------aaqgidFQRVGTFI------DRLYYlWPRAFDNFI-HSPL----LGLGfgsyddlyyrysdVIPHL 305 Escherichia coli
Q01XB1       250 --------------------AGDLDSNQ------FRVVC-RRAGWAIVK-QHPW----FGIGpeqvn----qnaqLLSYI 293 Candidatus Soli...
KQB91782     294 -----sdedggfldeepddeEATQDEETtnravvSRVTL-WKTGWVMMK-ENPV----IGVGign-------ylvRYKEY 355 Geobacillus sp....
ABS75602     338 --------------------QQPLPSNL------ARANL-LKNAFHYVI-DSWG----FGVGa------------GNVSY 373 Bacillus veleze...
Q4K127       275 ------------------fiQEHNINSM------ARTDL-WKGVESTYN-FAPIf---MGRGigf--------vtKWMDN 317 Streptococcus p...
Q4JZ62       270 --------------------DNKSGTGSa----tIRFDD-YKAGFLAWQ-KSPI----WGLGi------------SDGLR 307 Streptococcus p...
Q97ER0       278 --------------------SASYIKAD------NRWIK-WQVAIEYIK-KY------WAIGa-----------pFNIKV 312 Clostridium ace...
EDO56990     453 YSDEMIEVTGTVYDSAHNEYLQYLVTMGIVGLITYL 488 Clostridium sp. L2-50
Q9AQJ1       276 --VKELWLNSDLPLGSHSTYIGYFYKTGLFGLINVI 309 Streptococcus agalactiae
WP_011721620 345 NDELYTVLISNIWPATHNIYCRIFCELGIIGLVIWG 380 Clostridium novyi
Q9X4C1       306 LAIKEGAMVRHSEAHAHNSTFTILAELGVVGYLLFI 341 Escherichia coli
Q01XB1       294 PADEPRPLPTGAYVHLHNLYLQYAAERGVPALLFFL 329 Candidatus Solibacter usitatus Ellin6076
KQB91782     356 VTKYPELYIGHDQYSVHNSYLKVGAETGFLGLIAFV 391 Geobacillus sp. PA-3
ABS75602     374 YLKAEPVYDTGGVVEVHNWLVEIMANFGVLTMLGYL 409 Bacillus velezensis FZB42
Q4K127       318 NWMTLNINGLTGSMGIHNDILKYYIEIGFVGLFIYF 353 Streptococcus pneumoniae
Q4JZ62       308 AIEQHMDRTVRYNLGYSNSFFVVLAQGGIMLASYYF 343 Streptococcus pneumoniae
Q97ER0       313 QMYAYVNSAITSVEFSDNLFLEIASRFGVPLIACIF 348 Clostridium acetobutylicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap