4LT6,1Q78,2O1P


Conserved Protein Domain Family
PAP_central

?
pfam04928: PAP_central 
Poly(A) polymerase central domain
The central domain of Poly(A) polymerase shares structural similarity with the allosteric activity domain of ribonucleotide reductase R1, which comprises a four-helix bundle and a three-stranded mixed beta- sheet. Even though the two enzymes bind ATP, the ATP-recognition motifs are different.
Statistics
?
PSSM-Id: 398542
Aligned: 99 rows
Threshold Bit Score: 314.835
Threshold Setting Gi: 122047328
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4LT6_A        26 GITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTF 105
Q9U2P3        13 GVSQPISLAHPDSKDIAQTTLLIETLKKFGSYEPKEETEQRMEVLRNLNRLVKEWVKNVTAMKIPNGEGVNAGGKLFTFG 92  Caenorhabditis ...
EGT55877      17 GVSQPISLAQPTPKDISLTCSLLQELKSFGSFEAKEETTKRIQVLQFLNATVKKWIQGISASRLPNGKFFEAGGQVVSFG 96  Caenorhabditis ...
XP_003117444  11 GISQPISMDFPNKKDLLLNKSLTETLKSFNCFEPSEETSQRVKVLNKLNFLVKKWIHLLTITRIPMDVDAGGKLIAFGSY 90  Caenorhabditis ...
CAA90398      20 GVSQPISTALPNAKDLELTSSLQKTLNQYNSYEPQEETSQRVKVLQKLNGCVKQWIQKITEARYPKDQLFNAGGQLMAFG 99  Caenorhabditis ...
Q09995        15 GVSQPISTAFPKANDVALTSSLQSSLEEFKSFESKQETLLRIKVLKNLDGLVKDWVQKTTISRIPKDQMFNAGGKLIPFG 94  Caenorhabditis ...
PDM80851      14 GVSQPISMAKPTEKEVVMSDQLDGTLKSFNLYESEEEMETRLEVLRNVNSLVKRWVKEVSLTKMPADECEKVGGKLFTFG 93  Pristionchus pa...
XP_004343782  10 GMTPPLLIADPSPRDVELSRQLEQTLRDHDLFETEEEAQTRHMVLARLDSIVKQWVIQVLTAKNEMPPDTEPGGKVFTFG 89  Capsaspora owcz...
Q4E647         6 GPTKPLEVPPAQPRDLAESKRLCETMATVVADRVRE-------AIDLIELTAHRLVDQITAEPEERWVRAYPFGSCGLGA 78  Trypanosoma cruzi
Q4N9S7        14 GITDPVSHEGPTNNDLKASRELLNLLKSHNLYETEEGKKRREDILESLNRLLQQFVRRQAKITRGLTDQEASQVSGKLLT 93  Theileria parva
4LT6_A       106 GSYRLGVHTKGADIDALCVAPRHVER-SDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTIS 184
Q9U2P3        93 SYRLGVHSSGADIDTLAVVPRHIDR--SDFFTSFKEMLNNDPNVTELHGVEEAFVPVMKLKYSGVELDILFARLALKEVP 170 Caenorhabditis ...
EGT55877      97 SYRLGVHSSGGDIDSVVIAPRQVSR--ADFFTSLKDILIRNPNVKNLNAVEKAFVPIMTFEFAGVDVDLLFARLDLAVIP 174 Caenorhabditis ...
XP_003117444  91 RLGVHSSGSDIDTLVL--------------------APRHVTRLDFILENFTAFVPIMTFKYSGIDIDLLFARLDMPTVP 150 Caenorhabditis ...
CAA90398     100 SYRLGVHSSGADIDTLVLAPRHATR--ADFFSSFKQMLAKDPEVTNLCAVENAFVPIMTMKYSGIEIDFLFARLALKEVP 177 Caenorhabditis ...
Q09995        95 SYRLGVHSSGADIDSIVVAPRHITR--SDFFNSFKDILAKNPEVTELCAVEKAFVPIMTLKYSGVDIDILFARLALKSVP 172 Caenorhabditis ...
PDM80851      94 SYRLGVHGRGADIDSLCVVPRHIDR--SDFFTSFYKMLSEDPNVTDLHAVEDAFVPVIKLYYNKIDMDILFARLALKEVP 171 Pristionchus pa...
XP_004343782  90 SYRLGVHGRGADIDTLCIAPRGVTRD-DFFQSLVELLREQSETSELTPVTGAFTPIITLKFSGVDIDLLFAELPGVLSVS 168 Capsaspora owcz...
Q4E647        79 SVADSDLDIVLFCSFKVTAEV-----------FFREFPPLLQPVVGNVVLVPARVPVVKFSYSGTSVDVVFVSAALAAPP 147 Trypanosoma cruzi
Q4N9S7        94 FGSYRLGIVAPDSDIDVLCLCPRSVTrESFFSDFYNTLNKVDGISKLQAVPDAYTPVIKLYFYDISIDILFANLDAPTVS 173 Theileria parva
4LT6_A       185 DNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKE-TFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQ 263
Q9U2P3       171 DTQELSDDNLLRNLDQESVRSLNGCRVAEQLLKLVPRQK-EFCVTLRAIKLWAKNHGIYSNSMGFFGGITWAILVARACQ 249 Caenorhabditis ...
EGT55877     175 EKIDLTDDNLLKNMDQESVRSLNGVRVAEKLLQLVPNRE-SFCMTLRAIKVWAKSHGVYSNAMGFFGGITWAILVARACQ 253 Caenorhabditis ...
XP_003117444 151 DNIDLSDDNILKNLDPESVRSLNGCRVAEQLLKQVPNQS-TFCETLRAVKLWAKNHGIYSNAIGFFGGIAWAILVARTCQ 229 Caenorhabditis ...
CAA90398     178 EDLDILDDALLKNLDQESVRSLNGCRVAENLLKLVPNQE-NFCITLRAIKLWAKNHGIYSNSMGFFGGITWAILVARACQ 256 Caenorhabditis ...
Q09995       173 EDLNILDDSLLKNLDEESVRSLNGCRVAEQLLKLVPHQK-NFCITLRAIKLWAKNHGIYSNSMGFFGGITWAILVARICQ 251 Caenorhabditis ...
PDM80851     172 DDQTLHDDMLLKNLDEKCIRSLNGSRVADQILRLVPKVE-TFTLTLRAIKLWAQNHGIYSNVLGFLGGVSWAILVARVCQ 250 Pristionchus pa...
XP_004343782 169 ENLNVMDNAILRNCDMATVRSVNGSRVANYILQLVPDRD-NFRMALRAIKLWANNRGVYSNKLGFLGGIAWAILVARTCQ 247 Capsaspora owcz...
Q4E647       148 TTEQLLDDSFLLQVARDTRHSVNGLRTVLEVKRRLPVAYdVFTTVLKSVKLWAMRRKVYGNLYCYPSGVVLAIMVARICQ 227 Trypanosoma cruzi
Q4N9S7       174 PHINVLDDNILRNMNDSTVRSINGCRVASYILDSVPNKN-YFRTTLRFIKLWASRRKIYSTVVGYLGGVAWAILTARVCQ 252 Theileria parva
4LT6_A       264 LYPNAAASTLVHKFFLVFSKWEW---PN-PVLLKQPEEs-------nLNLP--VWDPRVNPSDRYHLMPIITPAYPQQNS 330
Q9U2P3       250 LYPNASPSRLVHRMFFIFSTWTW---PH-PVVLNEM-NndrndiptlCEL---VWDPRRKNTDRFHVMPIITPAFPEQNS 321 Caenorhabditis ...
EGT55877     254 LYPNASPSRLVQKVFYVFSTWNY---PS-PIVLCMP-TrerpdmlalDNL---CWG--RNHADRFHLMPIITPAFPEQNS 323 Caenorhabditis ...
XP_003117444 230 LYPNAAPSKLIQKVFFVFSTWNW---PS-PVILKHMENrfdm--qnlSQL---VWDPRRNYADRLHLMPIITPSFPEQNS 300 Caenorhabditis ...
CAA90398     257 LYPNASPSKLIQKVFFIFSTWKW---PA-PVLLDFI-SsdrmdlaqlNQL---VWDPRRNQSDRYHLMPIVTPAFPQQNS 328 Caenorhabditis ...
Q09995       252 LYPNAAPSRLIQKVFFIFSTWNW---PA-PVLLDYI-NcdrtdlaqlNQL---VWDPRRNHADRYHLMPIITPAFPQQNS 323 Caenorhabditis ...
PDM80851     251 LYPNYAPSKLVNRFFMVFAKWEW---PH-PVLLKDIDS-----------------SPR-------PDISALHDLIPSHAD 302 Pristionchus pa...
XP_004343782 248 LYPKSSASTIVARFFRVFHNWSW---PT-PVWLKAMEEdr--------sLAlpNWNPVINASDARHLMPIITPAYPSMNS 315 Capsaspora owcz...
Q4E647       228 VMPASHPNVLLRFFFLFYTQWLSrhdRIsPVYITTSLEsrg-----ripGLpdSWDP-RRDACRDDLLPVINPAYPYVND 301 Trypanosoma cruzi
Q4N9S7       253 LYPNCAPNQLIEKFFRVYSVWQW---EC-PVTLCKIKEppn----ipGLMSfkVWDPRVNPQDRHHLMPIITPAFPSMNS 324 Theileria parva
4LT6_A       331 TYNVSTSTRTVMVEEFKQGLAVT--DEILQGKSDWSKLLEP 369
Q9U2P3       322 THNVTRSTATVIKNEICEALEIC--RDISEGKSKWTALFEE 360 Caenorhabditis elegans
EGT55877     324 THNVSRSTMEVIKKEMTDALTIC--NDVFEGKCDWKHLFEE 362 Caenorhabditis brenneri
XP_003117444 301 THNVSRSTLQVIQNEMKEAFKIC--EHVQKGKATWKDLLEE 339 Caenorhabditis remanei
CAA90398     329 THNVSRSSMKVIQEEMKDALITC--DNIQNGSCNWMDLLEE 367 Caenorhabditis elegans
Q09995       324 THNVSRSSMKVIQDEMKKALIIC--DKIHEGTLEWRDLLEE 362 Caenorhabditis elegans
PDM80851     303 HYSRFPRTEFDIQR-----LEIT--TDIMEGHCEWKELFEE 336 Pristionchus pacificus
XP_004343782 316 THNVSMSTLRVMTEEFARGMQVT--LDIEVGKVGWPVLFEK 354 Capsaspora owczarzaki ATCC 30864
Q4E647       302 ARNVGRCSLEVFYAELTYAYRLL--SNLET-P--LEAIWEP 337 Trypanosoma cruzi
Q4N9S7       325 THNVTATTKRVITEELMRALEIFktSNLTNVEL-WEKVLEE 364 Theileria parva
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap