3BMA,6O93


Conserved Protein Domain Family
DltD

?
pfam04914: DltD 
Click on image for an interactive view with Cn3D
DltD protein
DltD is and integral membrane protein involved in the biosynthesis of D-alanyl-lipoteichoic acid. This is important in controlling the net ionic charge in lipoteichoic acid (LTA). This family is found in bacteria of the Bacillus/Clostridium group. DltD binds Dcp and ligates it with D-alanine. DltD does not ligate acyl carrier protein (ACP) with D-alanine. It also has thioesterase activity for mischarged D-alanyl-acyl carrier protein (ACP). DltD is thought to be responsible for discriminating between Dcp involved in the D-alanylation of LTA, and ACP involved in fatty acid biosynthesis.
Statistics
?
PSSM-Id: 398534
Aligned: 57 rows
Threshold Bit Score: 208.611
Threshold Setting Gi: 157699380
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BMA_C         18 AVATTIDSFKERSQKVRALSDP-NvrFVPFFGSSEWL---RFDGAHPAVLAEKYNRSYRPYLLGQGGAASLNQYFGMQQM 93  Streptococcus ...
USDA:Abu_1283  29 ILEYYTKPLQDTLQKTVSLQTDlEsgKIVLFGSSELVk-yPNQRFLPQKFFNNE-LNIPLRVQGNEGHQTFVIMSQLAAL 106 Arcobacter but...
Q7MZB1         50 IPTITDQHNAIDFLKEKSLEYGfKhnHVILFGSSELTn--RTHKFIPYDFLTKN-LNIPTIGIGKAHFELLAIYGYLSAY 126 Photorhabdus l...
WP_015395588   42 GKKFSDFVKDKSSLDKKLLSDK-G--DLFLLASSEMS---IKVPQNPLKLFPIKGENYDLSGFGRAFSQSLQQANYLGGA 115 Clostridium sa...
EHJ02312       42 GKLRFDTVKDKSSLDKKMLSDN-G--NMFLLGSSELG---ISVPQNPLDFFPFNGANYNLSCFGRPFTQDLQEASYLGGG 115 Clostridium sp...
jgi:Olsu_1218  57 DYVVDGTKFDAVDWTLANMSDV----GRLSLGSSEFYiskNLVAQCPQAVFGESNCGIDLTYIGEAYDQSLWQTIAAGAY 132 Olsenella uli ...
CCY69926       37 GTWISATKFGCNDGMKKLVDNDn---VFAVFGSSELKh-cQRSGFHADSIYKN--SDIKPVFIGKGGFQSLGHAIILGSI 110 Eubacterium sp...
CDC08966       36 GTWVSDAKSQSGSTLKKMAADEn---AVLIFGSSELRh-gQGSGFHGDTIFDG--ADMDPIYVGKAGYQSLTHAITLGAV 109 Roseburia sp. ...
CDB02582       33 NADFGTWISTKKDLSYRAVTSNiEddTVLMMGSSEFHh-gNKTPYHPTNIFRD--LNMNVMCMGAAQNQSLSHAITLGAI 109 Firmicutes bac...
WP_013977501   33 NRKFNYWYSSFKDNSYNAISQNlHksTMPVFGSSEIGh-gAKLSYGPQRLLER--TNTDIMTIGCAYNQCLNHSIVLGSV 109 Clostridium sp...
3BMA_C         94 LPQ-LE-NKQVVYVISPQWFS--KN-GyDPAAFQQYFNGDQLTSFLKHQS-GDQ----ASQYAATRLLQQ--FPNVA--- 158 Streptococcus ...
USDA:Abu_1283 107 DNEtIRnNARVVVLLSPSWFTgsNEnGlTMPKFLEYMYSGMMNKLYFESEtDDKyrylISDYIKENVSLIkePSFIYkyp 186 Arcobacter but...
Q7MZB1        127 QEY-LNkDSRIVIILSPGWFE--KT-DlLPQAYNSHFPSYIANKLANDESaKNI----FSNYLNENQDNF---ENLNatq 195 Photorhabdus l...
WP_015395588  116 D---INdNQKVAYVLSIQWFE--KQnElDPASFVANFSEVQFYKFLNNPKiSEN----NKRYYADRVYNFltKAKKYsp- 185 Clostridium sa...
EHJ02312      116 D---IEdNQKVVYVLSIQWFE--DEdGlQPDQYAANFSEVQFYNFLKNPKiSEE----NKRYYAQRVYDFltKAKENqp- 185 Clostridium sp...
jgi:Olsu_1218 133 ASR-TK-RRQCMVFLSPQWFF--RG-GdRDNRFSTKFSYELFRAFCRNGDiPDE----LHGYVRKRAGALgvDSSLLaa- 202 Olsenella uli ...
CCY69926      111 GQE-LK-GKKVVISVSPQWFK--SY-GfRKDAFGSMYSETNMIAFLKNKEiSDE----TKDYVIKRIKELtdENPTMwkn 181 Eubacterium sp...
CDC08966      110 GSQ-AA-NKKAVLIVSPQWFK--EN-GvKSTAFEAAFSEEEYIALLENPDiSQE----TKDYINGRLQNImaDNETMsek 180 Roseburia sp. ...
CDB02582      110 APD-MK-NKKVVLIVSPSWFA--KK-GvDGSGFAARFSESMYEAFLKNDQlSDE----TKKAITQRTKQLleVSPGAqkr 180 Firmicutes bac...
WP_013977501  110 GRQ-LK-GKKVVLILSPSWFY--RG-GlSGARYEMRFSETEYSAFMRNPDlPAD----VKEYVARRSRHLlkKNDTLrrh 180 Clostridium sp...
3BMA_C        159 MKDLVQk--lASKEELSTADNEMI----E-LLARFNERQASFF--------GQFSvrgyvNYDKHVAKYLKil-pdQFSY 222 Streptococcus ...
USDA:Abu_1283 187 LNVLEKd--yLNNE----------------IKKFIIQNFDYKNvkvetlnyVKPK----------------------LDY 226 Arcobacter but...
Q7MZB1        196 LKLIHKd--nIIASSVTNILNYIAearvN-IKNIITDNHEIKAdniyvlheGPLM------------KKQFqiantEVQW 260 Photorhabdus l...
WP_015395588  186 eAYYAKl--yLDSSKFSTFQKAAFkpyyE-MKQYLLDVQDK----------ALIY-----EELKDLPNIADkkqpkEIDW 247 Clostridium sa...
EHJ02312      186 eAYYAKl--yLDSSAFANMQKILLspyyE-VKQYLLGIQDK----------ALIY-----QKLKGLPNKNSgpilrTINW 247 Clostridium sp...
jgi:Olsu_1218 203 ---------aDQDGPLDAINDLQL------HEAQTVRLRTKLP--------QVIA-----GAPSKSAIRMSgtatgEPDW 254 Olsenella uli ...
CCY69926      182 IRQDIKwyrdNNGNVIDTVRKN--------VHSALANYKADTKlyiasvvkGYSN------------DTNEggkdrITHW 241 Eubacterium sp...
CDC08966      181 VKKAREw--yQPKDDNTAEQPGWLeqkkAdFHKVLLEEKNNYKvmaealmdGISN----------HRSKESgaklsQATW 248 Roseburia sp. ...
CDB02582      181 AETAEKvilsENVSLEERVTFA--------SNRWVTEEKENINiglmwklaGGKN----------KSQYQQgeqveEPDW 242 Firmicutes bac...
WP_013977501  181 AALYNRin-gVGGKKATGFDRISYr-----ILNAYTTDRDYLTmrilmkkkGIRF---------LDHYQGPadtlkHINW 245 Clostridium sp...
3BMA_C        223 QAIEDVVKADAEKNTSN-NEMGMENYFYNE--QIKKDLKKLK-DSQKSFTYLK---------SPEYNDLQLVLTQFSKSK 289 Streptococcus ...
USDA:Abu_1283 227 DKLRVEAKNIEIPSSN--NSFGINNEYYSK--YIEP-------EIVKNNFPFSiiippeldkNQEFQDFLVLLDFLDNYK 295 Arcobacter but...
Q7MZB1        261 LDLANDAKNIELKNMSK-ETQWVNKKYYEK--YVKDk--KSKkAFPNGIKY-----------SKEMNAFDNILNLLTKYN 324 Photorhabdus l...
WP_015395588  248 DEEYKKIENENEKLIST-NELKLEDNYYKE--YLGSTVSKHK-GECKSDDLLS---------AKEMDDYKFFLSVCKDLN 314 Clostridium sa...
EHJ02312      248 DDEYAKVEKDNEKIVSTnNQFNLEDKLYNW--TLKDNIDKHK-GESENENLMT---------SKEMDDYKFFLSVCKDLD 315 Clostridium sp...
jgi:Olsu_1218 255 DALMEQADLDGAAACTN-NELGVHDDYWAK--NHIY-------KPELDQSFDQa--------DSEYADFACTLDVLRVCG 316 Olsenella uli ...
CCY69926      242 NKLYKKAVKRGEKKSGH-NRFGMSDRIYNK--NYKE---KVKkKAFKDLQYTSd--------SMEFDDLKCFIDICRQEN 307 Eubacterium sp...
CDC08966      249 EQLRKEAETEGHKLSDG-NDYGMFDSVYKG--TYQT---LIAnGKHKNPKYTLd--------SMEFSDLECFLSICREEG 314 Roseburia sp. ...
CDB02582      243 DKLAQEADQSIEGKTN--NQFHMIDKLFKN--KVEPt-mKDRkDADLNRTYGD---------SPEYDDLRLFLDVCREQN 308 Firmicutes bac...
WP_013977501  246 EKWKQKAVSASPAVN---NPYYMAPKAWKKfsHIEE---KAR-GLHRDSSYEV---------SPEYEDLECFLKVCKAEG 309 Clostridium sp...
3BMA_C        290 VNPIFIIPPVNKKWMDYAGLREDMYQQTVQKIRYQLESQGFtNIADF---SKDGGEPFFMKDTIHLGWLGWLAFDKAVDP 366 Streptococcus ...
USDA:Abu_1283 296 IKPLFIMQDLNP--YVFVG-NREEANELMAIIKSKVLEHNF-EYMDMwtyKKENYEMNSLTDIVHLDELGWIRVNQKIID 371 Arcobacter but...
Q7MZB1        325 VDALFIMQPLNP----YVYTDTNDFKLVENIISEKIKSHGM-GYLNL---IEEQYQPGVLTDIMHMGEYGWLLTDKAIVE 396 Photorhabdus l...
WP_015395588  315 IKPYIILQPANGWYADYEELSKDARQNYYEEIKKLSKDSGF-EVLDL---SQYEYKQYFLFDTQHFGKEGWLKVDEEIYK 390 Clostridium sa...
EHJ02312      316 IKPYIVIPPVNGWFYDFQGLTKDKRKEWDEKVNEIAKDNNL-DVLDL---QAYDYKKHFLVDTKHLGEEGWLRVSEGIYK 391 Clostridium sp...
jgi:Olsu_1218 317 MDVLVVMQPMHGAWYDYVGVPSDVRDVWYDRVRRICHEHEA-TYADF---HTCEYERYFFCDTVHPGWRGWVRIERAIYH 392 Olsenella uli ...
CCY69926      308 IDVMMVMQPLNAKWADYTNFPKAKRDELYGAVRNFAKNNNV-KLADL---TSMEYDDYMFEDDSHLALKGLVYFNEQIYN 383 Eubacterium sp...
CDC08966      315 IEPLVVILPFNGYWYDYTELTAEERSTFYEKIRCIAEDYGV-QCADL---SGNEYTEYYFEDNSHPALKGLVDLNEAIYE 390 Roseburia sp. ...
CDB02582      309 VEVMLIMLPVNGWWYDYTGFPKENRQAFQTEVEKVAQEYGV-KTCNF---FDQCYTPGFLEDVVHPAGKGWVRINEEAYK 384 Firmicutes bac...
WP_013977501  310 IQPLLILQPVNGYWFDYTGLPEIRRDVLRYKIDNIASRYQA-QVADL---SNESYTKNFFEDAVHPYKLGWVTINEQIYK 385 Clostridium sp...
3BMA_C        367 FLS 369 Streptococcus pneumoniae R6
USDA:Abu_1283 372 YFM 374 Arcobacter butzleri RM4018
Q7MZB1        397 HFA 399 Photorhabdus laumondii subsp. laumondii
WP_015395588  391 HFK 393 Clostridium saccharoperbutylacetonicum
EHJ02312      392 YFN 394 Clostridium sp. DL-VIII
jgi:Olsu_1218 393 YLN 395 Olsenella uli DSM 7084
CCY69926      384 FYK 386 Eubacterium sp. CAG:161
CDC08966      391 FYR 393 Roseburia sp. CAG:45
CDB02582      385 FFK 387 Firmicutes bacterium CAG:145
WP_013977501  386 FYN 388 Clostridium sp. SY8519
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap