Conserved Protein Domain Family
Tcf25

?
pfam04910: Tcf25 
Transcriptional repressor TCF25
Members of this family are transcriptional repressors. They may act by increasing histone deacetylase activity at promoter regions.
Statistics
?
PSSM-Id: 398532
Aligned: 86 rows
Threshold Bit Score: 206.256
Threshold Setting Gi: 74862509
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAQ40524      252 FKLE---KYKLYLEAENLFYVLLDTHDI-EAMHNLLKKYPFHVDTLLVLSEYY-NESNNFEVANKFTKLSLLLLQHVFHI 326  Plasmodium kn...
Q38EB2        296 YLDV---SAPESQRADADLAECEKLVDAvDGLMGCLGKTPYHIPTLIVVSNVFeTMG-NVPRALEVIDLALYHLGVLLQ- 370  Trypanosoma b...
Q4CST5        296 YLDD---SSAETRRAEAALAVCGSMHAGvEGIMTCLAAAPYHIPTLIIASNLFeTMG-NIPRAQEAIDIALYHVGVLLS- 370  Trypanosoma c...
XP_001613240  234 FKLE---KHKLYLEAENLFYALLDTHDI-EAMHNLVKKFPFHVDTLLVLSEYY-NESSNFEVANKFTKLALLILQHVFHI 308  malaria paras...
Q7RGJ4        246 FKIE---KEKLYLEAENLFYLLLDTHDI-QSMNDLIKKYPFHIDTILILAEYY-NETNNYEVANQYIKMALLLLQNIFHM 320  Plasmodium yo...
EMG47197      296 FQFSqtnNIKERVANTRFYASVVMTPDP-DSLMQLLQQYPYHVETLLQVAMVLlRQGDNKSTSNALVERALFAFDRSFHK 374  Candida malto...
CCE44816      292 FKFNkvtDTRSRIANTRFYASTVLTPDP-ESLMQLLQSNPYHQETLLQVAMVLlRQGDNKATSNALIERALFTFDRSFHK 370  Candida parap...
XP_001525925  388 FRFNkvhDIKNRVANTKFYAATVLTPDP-ESLFQLLQVSPYHHETLLQVAMVLlRQGDNKATSNALIERSLFTFDRSFHR 466  Lodderomyces ...
EEQ40478      294 FKFNkinSVTERMANSKFYASVVMTPDP-ESLMQLLQQHPYHVETLLQVAMVMlRQGNNKATSFALVEKCLFVFDRSFDK 372  Clavispora lu...
CCE81218      355 FKFSkvsTIQERLANTKFYASVVMMADP-DSLIQLLQHYPYHAETLLQVSMIMlRQGGDKSVANALIEKCLFVFDRSFNM 433  Millerozyma f...
CAQ40524      327 DFhpnnlNKER-YIYVNPYLYDNKALFKALYMHMLSLENEACTITSLEIAKLLCKIDLQFDLCSILLRIDSLILKCNLFE 405  Plasmodium kn...
Q38EB2        371 SFplrqtARQRc---VPFSIPSNKQLFQVLRCGIHHALRKAAVRTAWETCKLLYSLDPK-DPFGSLFLLDYLALRSKGWA 446  Trypanosoma b...
Q4CST5        371 RFpvrqtVRRRc---LPFGVTPNRQLFQVLRCGVHQALRKAATRTAWEIAKLIYSLDDT-DPLGMLLQLDYLALRAKQWA 446  Trypanosoma c...
XP_001613240  309 DFspnslNRSR-EIYVNPHLYDNKALFKALYMHMLSLENEACTITSLEVAKLLCKMDLQFDLCSILLRIDSLILKCNLFD 387  malaria paras...
Q7RGJ4        321 NFnidyiNNNH-KIYVNPQLYDNKVLFKTLYMHMQSLEYEGCTITSLEIAKLLCKIDLCNDLCGILLRIDGIMLKGNVFE 399  Plasmodium yo...
EMG47197      375 NFhellcQASTgLIRLPYERFMNRQFYLCLFRYIVALGERSTFFTALSYCKLLLSLNPAEDPLGVRYFIDFYAIMSEELN 454  Candida malto...
CCE44816      371 NFhelvmSAQNgLIRLPYEFFSNRQFYLNLFRYIVSLGERSLFETALTFCKFLLSLSPAEDPLGTRYFIDFYCIMSEEFE 450  Candida parap...
XP_001525925  467 VFhellsSAQNgLIRLPYEFFSNRQFYLNLFRYIVSLGERSLFSTAMSYCKLLLSLSPAEDPMGVRYFMDFYAIMSDNFD 546  Lodderomyces ...
EEQ40478      373 TFhemlcEGRTgLLRLPYESFMNRQFYLCLFRMISALGERNTFYTALNYCKFMLSLSPAEDPLGVRFFIDHYAILSEEYQ 452  Clavispora lu...
CCE81218      434 KFhellsNGKLsLIRLPYECFLNRQFYLCLFRYITSLGERSMFSTAFAYCKFLLSLSPAEDPLGVRYFLDFYAMMNDDYH 513  Millerozyma f...
CAQ40524      406 FLIYFSFNFVIQNvqcvvpparlsqiiatsfpsaegnffhdqmkfpeilppkweediwkgqpaqyyfdqqgnvhageapa 485  Plasmodium kn...
Q38EB2        447 WLVHVYYLLIREScripnsrtlpptaec---------------------------------------------------- 474  Trypanosoma b...
Q4CST5        447 WLVQVSFIVARELerhaegkvddt-------------------------------------------------------- 470  Trypanosoma c...
XP_001613240  388 FFIYFSFNFVIQNvqcvvpaarlseilatclhgemrlpgshrpewdehawkrqdggeageaaaaggavavagggaeegae 467  malaria paras...
Q7RGJ4        400 FLVFFSFNFILQNihyvmplsrtneiisdfffnendikngenciteklnpneeishnnipttnqstneisktqenil--- 476  Plasmodium yo...
EMG47197      455 YLIQFSES------------------------------------------------------------------------ 462  Candida malto...
CCE44816      451 YLIQLSKS------------------------------------------------------------------------ 458  Candida parap...
XP_001525925  547 YLIKFRKS------------------------------------------------------------------------ 554  Lodderomyces ...
EEQ40478      453 YLIDLVDS------------------------------------------------------------------------ 460  Clavispora lu...
CCE81218      514 FLTGFCES------------------------------------------------------------------------ 521  Millerozyma f...
CAQ40524      486 tatetattaiatpptvvvappaytgdegessskanqlahgyteegvspsteprtdqldqmsdekreppndadwndeplyr 565  Plasmodium kn...
Q38EB2            --------------------------------------------------------------------------------      Trypanosoma b...
Q4CST5            --------------------------------------------------------------------------------      Trypanosoma c...
XP_001613240  468 egeaaegespshnnqvgeaagggaaeggapptpe-------rrtdeldptddakreppndadcndgppyqmegeneselp 540  malaria paras...
Q7RGJ4        477 -------------------------------------------------------------------------------k 477  Plasmodium yo...
EMG47197          --------------------------------------------------------------------------------      Candida malto...
CCE44816          --------------------------------------------------------------------------------      Candida parap...
XP_001525925      --------------------------------------------------------------------------------      Lodderomyces ...
EEQ40478          --------------------------------------------------------------------------------      Clavispora lu...
CCE81218          --------------------------------------------------------------------------------      Millerozyma f...
CAQ40524      566 menedgselsmgpkqysvdekdnpmegvckggkrfedcgaqtaepakpaeqakntlqskllfENFEIrlhfilPNFAFSL 645  Plasmodium kn...
Q38EB2        475 -----------------------------------------------vnsgcsnlsnhelalSLSTL------PGFFFSA 501  Trypanosoma b...
Q4CST5        471 ---------------------------------------------------ndawsnrklalALSTL------PGFFFST 493  Trypanosoma c...
XP_001613240  541 vgherhsadeqgekgeqnegdpleggkgsgggkvsgggkvsggcncfeggragtalqskllfENFEIrlhfllPNFAFSL 620  malaria paras...
Q7RGJ4        478 meckenisslkrqdgdifddekiiyeqfsqnndftkklpeqdrnndkldylqnthtkkkydfQNYEIrlhfilPNFAFSI 557  Plasmodium yo...
EMG47197      463 --------------------------------------------------------------PLVTPysqwytPGIAFST 480  Candida malto...
CCE44816      459 --------------------------------------------------------------PLVTCytrwysPGIAFST 476  Candida parap...
XP_001525925  555 --------------------------------------------------------------PLVTCytrwytPGIAFST 572  Lodderomyces ...
EEQ40478      461 --------------------------------------------------------------PLTSTysqwftPGLAFSK 478  Clavispora lu...
CCE81218      522 --------------------------------------------------------------PLVTTykkwltPGLAFSC 539  Millerozyma f...
CAQ40524      646 PLSMYLKnNNlvdyheirlitvddlvrsftyeeceflsphcdirfdch---rdggrsekfrpdrldpsahgedhlgsaer 722  Plasmodium kn...
Q38EB2        502 ALAKLFLeREeathtqkggkls-------------------------------------------------------rvi 526  Trypanosoma b...
Q4CST5        494 ALAKYFLeREeatsavsgvsnkgk---------------------------------------------------sskvl 522  Trypanosoma c...
XP_001613240  621 PLSLYLKnNNgvdlqeirlisvddlvsafsyeecrflsphfairfdchggrakngndrlgqsdhaedhpdgatpdesapp 700  malaria paras...
Q7RGJ4        558 PLCLYLKnNTnvnyneineikkndilssfsyeeckf--------------------------liphfninfncywgnnnv 611  Plasmodium yo...
EMG47197      481 VLAHL--------------------------------------------------------------------------- 485  Candida malto...
CCE44816      477 VIAYL--------------------------------------------------------------------------- 481  Candida parap...
XP_001525925  573 ALAYL--------------------------------------------------------------------------- 577  Lodderomyces ...
EEQ40478      479 VLALL--------------------------------------------------------------------------- 483  Clavispora lu...
CCE81218      540 ALAHF--------------------------------------------------------------------------- 544  Millerozyma f...
CAQ40524      723 qqsahqqkKvQPSLSYSAHVTLLRALLCFPNFLQTFLNYNNFKTTkvVKKTiyetsfkdilssrpfsSPSLF-GLQEYET 801  Plasmodium kn...
Q38EB2        527 rdispaelH-AFHDTPPSGVMLADAIGRFPSAAVLLVEKVGSQAQ--PSVApaawk-------evvkGHMNNnGGQRLRV 596  Trypanosoma b...
Q4CST5        523 reltptqlH-AFRNTPPASVMLAHAISRFPSAAVLIVEKIGGQSV--VSSVpvswq-------divkAHELNtEENSLHV 592  Trypanosoma c...
XP_001613240  701 kvstneqkKgQPSLSFSAHVTLLRALLCFPNFLQTFLNYNNFKTTkvVKKTiyessfkdilasppfsSPSLF-RLGEFDV 779  malaria paras...
Q7RGJ4        612 snlcdkknI-SYSLSYSSHLFLIRALLFYPDFVQIFVKYNNFNTSkiVKNTiydisfkhilshppfsDNTLFsNKEEYEI 690  Plasmodium yo...
EMG47197      486 ----------KLDQKEKAREALVRAFKAQPYAAFRLYQQIGLGSN--LTVD-----------------EKSFkLTTEVKL 536  Candida malto...
CCE44816      482 ----------ELNKVDDAEREMQKAFEAYPYVAYRLLTDVALSSV--AGVK-----------------ESDFeVTHEVAV 532  Candida parap...
XP_001525925  578 ----------KLEQTELAIEELRNAVKEHPYTAYKILTEICISNN--VHLK-----------------DSDFdVDAETLI 628  Lodderomyces ...
EEQ40478      484 ----------YLGQTDKARAALKDAFSAHNYCSLQLLAVVGLATK--PPVK-----------------VSEVhKDDSIIL 534  Clavispora lu...
CCE81218      545 ----------NLDKIELAKEKLAVAFENFPYVSFKLLEQVCKVDT--LPVS-----------------EKDLeITDEDRL 595  Millerozyma f...
CAQ40524      802 VQKiilCYLEKNNIYYKSEKIITWFHVCSaflHELYMD------------------------------------------ 839  Plasmodium kn...
Q38EB2        597 AT----LWVARNAEMWNAAEPSGFLRRVIteeSGVYLKslsv-------------------------------------- 634  Trypanosoma b...
Q4CST5        593 AS----MWVARNAEIWKAADPCAFLRRVItedDGLWLKshrtdidanl-------------------------------- 636  Trypanosoma c...
XP_001613240  780 VQKiicCYLEKNNIYYKSERVITWFHVCSaflHELYRD------------------------------------------ 817  malaria paras...
Q7RGJ4        691 VQKiilAYLEKNNIYYKSEKMITWVHVCSafiHEMYKD------------------------------------------ 728  Plasmodium yo...
EMG47197      537 ATE---TYMVRCGVMWTEHAHRQFLHDEI---QQLFADwkpqqaktisstlf---------------------------- 582  Candida malto...
CCE44816      533 CAE---TYMVRAKLLW--QKHLDFLSTNL---EKLFKTkhkpvrgsffg------------------------------- 573  Candida parap...
XP_001525925  629 SAE---TYLVRAKILW--ASDLEFLTINL---ESNLAEnrqkssgwffgssgsssgsgsgsgsspgsnsggngsitntlk 700  Lodderomyces ...
EEQ40478      535 ASE---TYLVRASILWKEQNHRQFLHDEL---MKLFKTqsegsksswlg------------------------------- 577  Clavispora lu...
CCE81218      596 AGE---SYLVRAKFLWNNQAKLSFLEEEL---ISLFKSksskranysglssvy--------------------------- 642  Millerozyma f...
CAQ40524      840 --------------------PSaakaldkaraqwhskiplldINKYKDVRVGEFK---SSNYLLPDfmMEkNRTYSPHTP 896  Plasmodium kn...
Q38EB2        635 -----------------saaNPca----------------dvPTPWEHEMLREEDlmgTVMAAIPAh------------l 669  Trypanosoma b...
Q4CST5        637 ----------sasaavvtaeSPh------------------lPTPWKHASLTEEDilcQTLTTIPAh------------l 676  Trypanosoma c...
XP_001613240  818 --------------------PSaaraldkaraewhgkvhlldVSKYKDVRVGEFK---STNYLLPDfmMEkNRTYSPHTP 874  malaria paras...
Q7RGJ4        729 --------------------ELvakeldearkqwhrriplldINKYKGIRVSEFK---SRNYLLPDfmMEkTVSHPA--P 783  Plasmodium yo...
EMG47197      583 ------gllglsekdlssqeVP--------------------FNLVRFAILSGEN---KIMAKLPKklWS-RDDLFEYDL 632  Candida malto...
CCE44816      574 ----------flnakeipkeVP--------------------FNLIRFAILSGEN---KIMAKLPKsvWN-RDDLLEFDV 619  Candida parap...
XP_001525925  701 nffgrvglegststlaknkdVP--------------------FNLVRFAILSGEN---KIMGKLPQkiWN-RDDLHEYDV 756  Lodderomyces ...
EEQ40478      578 ----------kwfntkestdIP--------------------INLIRFAILSGEN---KVLAKIPEkiFS-RSDILEYDV 623  Clavispora lu...
CCE81218      643 ------slffgskpdtpsseLP--------------------LNLIRFAVLSGEN---TMMARIPKkvWN-TQELLEYDI 692  Millerozyma f...
CAQ40524      897 GAP 899  Plasmodium knowlesi strain H
Q38EB2        670 LDP 672  Trypanosoma brucei
Q4CST5        677 LDP 679  Trypanosoma cruzi
XP_001613240  875 AAP 877  malaria parasite P. vivax
Q7RGJ4        784 VPN 786  Plasmodium yoelii yoelii
EMG47197      633 LPP 635  Candida maltosa Xu316
CCE44816      620 LPP 622  Candida parapsilosis
XP_001525925  757 LPP 759  Lodderomyces elongisporus NRRL YB-4239
EEQ40478      624 IPP 626  Clavispora lusitaniae ATCC 42720
CCE81218      693 LPP 695  Millerozyma farinosa CBS 7064
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap