Conserved Protein Domain Family
NCD1

?
pfam04904: NCD1 
NAB conserved region 1 (NCD1)
Nab1 and Nab2 are co-repressors that specifically interact with and repress transcription mediated by the three members of the NGFI-A (Egr-1, Krox24, zif/268) family of transcription factors. This region consists of the N-terminal NAB conserved region 1, which interacts with the EGR1 inhibitory domain (R1). It may also mediate multimerisation.
Statistics
?
PSSM-Id: 398528
Aligned: 10 rows
Threshold Bit Score: 147.608
Threshold Setting Gi: 170036184
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_001071775   5 EPTTLGELQLYKVLQRANLLGYYDIFISHGGDDVQQLCEAGEEEFLEIMALIGMASKPLHVRRFQKTLQDWVTSPHLFQ 83  vase tunicate
XP_002595257   8 KPANLGELQLYRVLQRGNLLQYFDVFISQGGDDVQQLCEAGEEEFLEIMSLVGMASKPLHVRRLQKSLQEWVTTPALFQ 86  Florida lancelet
XP_011665953   9 MPQTLSELQLYRVLDRANLLPYYTNFILQGGDDVQQLCEAGEDEFLEIMSLVGMGSKPLHVRRLQKALQEWVASPAAFQ 87  purple sea urchin
Q17J65       118 TPSNEAELQLYRVLQRASLLNYYDTLLEMGGDDLQQLCEACEEEFLEIMALVGMASKPLHVRRLQKALQEWVTNPSAFQ 196 yellow fever mos...
XP_001845945  47 TPSNEAELQLYRVLQRASLLSYFDTLLAMGGDDLEQFTSSSQ-EFMEIVDLVGMQSKPLHVRRLQKALQEWIANPSAFQ 124 southern house m...
XP_009022947  10 vgiSKSEWILFKVLEKANLLQYYDNFISQGGDDVTQLCEASEDEFLEIMALVGMSSRPLHVRRLQKVLKEWISNPDMFg 88  Helobdella robusta
KRX45272      12 LPNSPSEWQLYLVLQRANLLQYYDTFISQGGDDVQQLLEAGEEEFLEIMALVGMASKPLHVRRLQKSLQEYGSNPSTFQ 90  Trichinella murr...
PDM60491     148 pPSTVSEWQLLAILHRANLLQYYDVFIDKGGDDVNQIMCSEESEFLEIMSIVGMLSKPLHVRRLQRALAQYSNDPTAFN 226 Pristionchus pac...
Q22002         3 TPTTLSEWQLLAVLSKANLVQYYDVFIAQGGDDINQIMACEEREFLEIMNLVGMLPKPLHVRRMQRALAEYSQDQTAFN 81  Caenorhabditis e...
ABM66025       8 LPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFS 86  black-handed spi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap