Conserved Protein Domain Family
AmoC

?
pfam04896: AmoC 
Ammonia monooxygenase/methane monooxygenase, subunit C
Ammonia monooxygenase plays a key role in the nitrogen cycle and degrades a wide range of hydrocarbons and halogenated hydrocarbons. This family represents the AmoC subunit. It also includes the particulate methane monooxygenase subunit PmoC from methanotrophic bacteria.
Statistics
?
PSSM-Id: 398523
Aligned: 12 rows
Threshold Bit Score: 339.333
Threshold Setting Gi: 189186460
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD85322      12 QQVTDKPAYDK-SEWFDAKYYKYGLLPILGIAVFWVWYQRTFAYSHGMDSMEPDFDRIWMGLWRVQMVVIALAAFSIWGW 90  Nitrosomonas eu...
Q3J890         6 RAVAQGVAEKEtADLFAWRGMWLAVAAFFAFYICVRWYEGVYGWKYGLDAFSPEFQTYWMNLLYIELVVEALATAALVSY 85  Nitrosococcus o...
Q6MZ18         6 EKAVSAAQAGEtDTIVNYKPAYITMGVMLVFYVGIRVYEQYFGWKAGLDSFAPEFQTYWMNLMWTELPLEFVAFCGIGGY 85  Methylocystis s...
CCJ06178       6 AEARSAARSAE--RIIDARPVLIGVAVLMFFVAILRLYEQVFAWRFGLDSFSPEFLLYWMGLLQFAILASCLGAVGLVGF 83  Methylocystis s...
CCD32212       6 QSAVGALERAE--PIVDLRGMWIGLAVLNGFYLVVRIYEQIYGWRAGLDSFAPEFQTYWMSILWTEIPLELISGIGLAGW 83  Methylocystis s...
Q60C16         3 TTTAGGIAAID-RPLLDKKWLVFAIGIYTVFYLWVRWYEGVYGWSAGLDSFAPEFETYWMNFLYTEIVLEIVTASILWGY 81  Methylococcus c...
WP_013817025   9 KADAAEA------PLLNKRNLTLGMLLYLVFYSFIRWYEGVYGWSAGLDSFAPEFETYWMNMLYIEIVCEVILFSGINGY 82  Methylomonas me...
WP_012463844   5 ttqtVSISIPE-RSAFSWKNLWIALAIITAFELAVNVYERTFAIAKGLDYFTPQYQTYWMSILYTELILEPTTLIALCSW 83  Methylacidiphil...
ABX56600       4 TTAATTIAIPE-RSLFSWNRMWLGVGLLSGWYILVNLYERAFAFTKGLDYTSPEYQAYWMNLLLAELALEALAFIAVCTW 82  Methylacidiphil...
MA:Minf_1591  13 evttsieVVPK-KEYFNNWRFYLYCILLSLFYGACMLYQRAFAITKGIDYTSQEFQQYWMTLFWGITIMNVVIWAVTWGW 91  Methylacidiphil...
CAD84856      10 ASSVSSRGYDM-SLWYDSKFYKFGMITMLLVAIFWVWYQRYFAYSHGMDSMEPEFDRVWMGLWRVHMAIMPLFALVTWGW 88  Nitrosomonas eu...
Q2Y665        16 ESSASSAAYDM-SEWYDSRFYKLGLLPILGMAVFWVWFQRTYAYSHGMDSMEPEFEQIWMGLWRFQMMLWPTLALIVWGW 94  Nitrosospira mu...
CAD85322      91 LLKT-RNtaEQLASLTPKQEIKR-YFYFMMWLGVYIFAVYWGSSFFTEQDASWHQVIIRDTSFTPSHIPLFYGSFPVYII 168 Nitrosomonas eu...
Q3J890        86 LIKT-RD--RNMEAMTPREELRR-YCTLYMWWVVYGVGLFWGASFFTEQDGAWHQTVVRDTDFTPSHIIEFYMSYPIYVM 161 Nitrosococcus o...
Q6MZ18        86 LWKT-RD--RNIDAVAPREEMRR-ILTLIGWLAVYAFSVYWGASYFTEQDGTWHQTVIRDTDFTPSHILEFYLSYPIYII 161 Methylocystis s...
CCJ06178      84 LWRT-RD--RDLANLGAAAETRR-LVYLVQWLLVFSLALFWGLSFFSEQTAVWHMTAVRDTDFTPSNIITFYIAYPLFAI 159 Methylocystis s...
CCD32212      84 LWKT-RV--RDMSTVTPRQEMKA-IADNAAWLVVYAAAIYWGASFFTEQDGTWHMTVIRDTDFTPSHIIEFYMSYPIYSI 159 Methylocystis s...
Q60C16        82 LWKT-RD--RNLAALTPREELRR-NFTHLVWLVAYAWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYII 157 Methylococcus c...
WP_013817025  83 LWKT-RD--RKVMSITPREELRR-HFTHWIWLVCYGWAIYWGASYFTEQDGTWHQTIVRDTDFTPSHIIEFYLSYPIYII 158 Methylomonas me...
WP_012463844  84 LWVT-RD--RAMENLAPAEELKR-YWNLGLFVVVYTVLLYWGASYYTEQDGTWHQTVIRDTDFTPSHIIEFYQSYPIYIV 159 Methylacidiphil...
ABX56600      83 LWIT-RD--KNLDNISPVEELRR-YWNLGLFIVVYTVAIYWGASYFTEQDGTWHQTVIRDTDFTPSHIIEFYQSYPIYII 158 Methylacidiphil...
MA:Minf_1591  92 IWYVyRD--RHLDQVTPGEELKRwYSNWLLTLGVYAWALVW-AVFFVEQDGVWHSSMVRDTEFTPSHIFNFYLSWPIFIN 168 Methylacidiphil...
CAD84856      89 ILKT-RDtkEQLDNLDPKLEIKR-YFYYMMWLGVYIFGVYWGGSFFTEQDASWHQVIIRDTSFTPSHVVVFYGSFPMYIV 166 Nitrosomonas eu...
Q2Y665        95 IWKT-RDtqEQLASLAVKKEIKR-YFYFLMWLGVYMFAVYWGSSFFTEQDASWHQVIIRDTSFTPSHIPLFYGAFPMYII 172 Nitrosospira mu...
CAD85322     169 MGIAMIIYAKTRLPLYNKGWSFPLIMVVAGPLMSLPNVGLNEWGHAFWFMEELFSAPLHWGFVILAWAALFQGGLAIQLI 248 Nitrosomonas eu...
Q3J890       162 VGLGSFTYAKTRIPYFAKGWSVPYLMLVFGPFMIFPNVGLNEWGHTFWFMEELFVAPLHWGFVFFAWFILAVFGVFLQVQ 241 Nitrosococcus o...
Q6MZ18       162 CGWGAFMYAHTRIPQFAKRISLAFLMFFAGPFMIFPNIGLNEWGHTFWFMEELFTAPLHWGFVFFGWFALAVFGVARQVL 241 Methylocystis s...
CCJ06178     160 IGLGAFFYAKTRLPTFAKGYSLAFVVLVVGVFMTIPNVGFNEWGHTFWAMDEGFAGPLHWGFVFFGWMSLAVFGVVLLIL 239 Methylocystis s...
CCD32212     160 LAIGCFFHAKTRIPYFAKGYSVAYLIVSIGPFMIIPNVGLNEWGHTFWFMEELFVAPLHWGFVFFGWMALGVFGVVIQLL 239 Methylocystis s...
Q60C16       158 TGFAAFIYAKTRLPFFAKGISLPYLVLVVGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVIFGWLALAVMGTLTQTF 237 Methylococcus c...
WP_013817025 159 TGTAAFMYAKTRLPTYHEGLHLMYLIAVIGPFMILPNVGLNEWGHTFWFMEELFVAPLHYGFVFFGWAALAIMGVVNTEV 238 Methylomonas me...
WP_012463844 160 AGVGSMVYAMTRLPQYAKAFSVPYAVLVGSPLMIFPNVGLNEFGHTRWFMEELFVAPLHWGFVMFGWGALAILGTWLQIC 239 Methylacidiphil...
ABX56600     159 LGVGSFMYAITRLPMFARAFSIPYAVLVGSPLMIFPNVGLNEFGHTRWFMEELFVAPLHWGFVAFGWGALAIMGVWLQAC 238 Methylacidiphil...
MA:Minf_1591 169 FGVAGLMLTRTRLPVMGKKWLLPLVMEVAWPIMFIPLIGENEWGHSAWILEEWFAAPLHWTFVPFAWAAVWFLGNGFDMF 248 Methylacidiphil...
CAD84856     167 CGVATYLYAMTRLPLFSRGISFPLVMAIAGPLMILPNVGLNEWGHAFWFMEELFSAPLHWGFVVLGWAGLFQGGVAAQII 246 Nitrosomonas eu...
Q2Y665       173 MGVSTFLYASTRLPLYNKGTSFPLLMAIAGPLMSLPNVGLNEWGHAFWFMEELFSAPLHWGFVVLAWAALFSGGIAVQVI 252 Nitrosospira mu...
CAD85322     249 TRYSNLVDVE 258 Nitrosomonas europaea ATCC 19718
Q3J890       242 PRMKELIGRE 251 Nitrosococcus oceani ATCC 19707
Q6MZ18       242 DRVIELSKEY 251 Methylocystis sp. SC2
CCJ06178     240 GRLRELLGAD 249 Methylocystis sp. SC2
CCD32212     240 LNIHRVIGKE 249 Methylocystis sp. SC2
Q60C16       238 YSFSHLFERD 247 Methylococcus capsulatus
WP_013817025 239 MAITKLLKKD 248 Methylomonas methanica
WP_012463844 240 PRVVELIKQv 249 Methylacidiphilum infernorum
ABX56600     239 PRVYELMKQV 248 Methylacidiphilum infernorum V4
MA:Minf_1591 249 PRIAAVLkat 258 Methylacidiphilum infernorum V4
CAD84856     247 TRYSNLTDVV 256 Nitrosomonas europaea ATCC 19718
Q2Y665       253 ARFSNLMDVQ 262 Nitrosospira multiformis ATCC 25196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap