Conserved Protein Domain Family
Peroxin-3

?
pfam04882: Peroxin-3 
Peroxin-3
Peroxin-3 is a peroxisomal protein. It is thought to be involve in membrane vesicle assembly prior to the translocation of matrix proteins.
Statistics
?
PSSM-Id: 398512
Aligned: 96 rows
Threshold Bit Score: 264.917
Threshold Setting Gi: 406697109
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AEVR:RTG_01316  15 RPRRFITYTTATLGTA--------YIAGKWALGRvlegAERGRREGWGREDLARRFNLNIQDSQFTVLALLPTLSQAVVG 86  Rhodotoru...
Q759H4               8 RHRGKLLGTGAVLGGLvvagvvaaVAAKRWVRRQ----QQRLSEQHYVREQIKRRFTQTQQDALYTMYELVPVLALVLGK 83  Eremothec...
XP_002553645        10 RHRSKLYFSSAILATLlttgavslYLIKKWLLRQ----QLKISEQQFVKEQIKRRFTQTQQDALYTIYELMPVLSLVLAK 85  Lachancea...
O94227              10 RHRKKFVVSSVLFATLfatcaitvYFSKRWLYKQ----HLKMTEQRFVKEQIKRRFVQTQQDSLYTLYELMPVMTLVLAK 85  Kluyverom...
XP_002496885        13 RHRGKIVFSLAIFGSLvtagsvflWLVKRWLYRQ----QLRLTEQHFIKEQIRRRFAQTQEDSLYALYELIPVFSLVVGR 88  Zygosacch...
CCE92499            14 RHRGKILTSVGIIASLltagsvcvYLVKRWLYQQ----QLKITEQHFIREQIRRRFTQTQEDTLYALYELIPVFAMVLAK 89  Torulaspo...
CCE62858            14 RNRKRFITAAALSTVIfatgsiflYFLKSWLYKQ----QLKITEQHFIREQIKRRFTQTQHDSLIVLYELLPVFVLILAK 89  Tetrapisi...
EDO18651            13 RHRGKIIVSTAVVATIfttgsiciYLIKRWLYKQ----QLKITEQHFIREQIRRRFTQTQQDSLYALYELLPVYSLVLTK 88  Vanderwal...
EJT44742            40 RHRGKLLISLTGIAALfttgsvvvFFVKRWLYKQ----QLRITEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWEMVLNE 115 Saccharom...
XP_003957222        12 RHRGKLVFTLTMVSGFvmttsmliYCLKTWLVRQ----QRRFNEERFIKEQIKRRFQITQEDSLITVYELLPVVSMVLND 87  Kazachsta...
WGS:AEVR:RTG_01316  87 -EMDVEGLTGELgerarrEREERVraeeerrRREeeederarakaaeeevakqslpngdanemhgttsisapltsttslg 165 Rhodotoru...
Q759H4              84 -ELDVEELVETL------KGKKL--------------------------------------------------------- 99  Eremothec...
XP_002553645        86 -DLDVDEIVGEL------KGKKLSrhlsqrsASV---------------------------------------------- 112 Lachancea...
O94227              86 -DFDLDSIVEAL------KGKKLQkklskgeIA----------------------------------------------- 111 Kluyverom...
XP_002496885        89 -KLDLEELVIAL------RDKKLNk------------------------------------------------------- 106 Zygosacch...
CCE92499            90 -KLDLEELLIAL------RDKKLSkgt----------------------------------------------------- 109 Torulaspo...
CCE62858            90 -DYNLDELVIAL------RDKKLKksqisaeK------------------------------------------------ 114 Tetrapisi...
EDO18651            89 -DLDLEKLVVAL------RDKK---------------------------------------------------------- 103 Vanderwal...
EJT44742           116 sNLDLDSIITQL------KDQK---------------------------------------------------------- 131 Saccharom...
XP_003957222        88 nDMDLNGIFGAL------KEKK---------------------------------------------------------- 103 Kazachsta...
WGS:AEVR:RTG_01316 166 qplhspllpmlnnhapalnpsapvfhprspspphpteaaevepstvslaqreqeggemgaswaevvkrdvpehaevaeek 245 Rhodotoru...
Q759H4                 --------------------------------------------------------------------------------     Eremothec...
XP_002553645           --------------------------------------------------------------------------------     Lachancea...
O94227                 --------------------------------------------------------------------------------     Kluyverom...
XP_002496885           --------------------------------------------------------------------------------     Zygosacch...
CCE92499               --------------------------------------------------------------------------------     Torulaspo...
CCE62858               --------------------------------------------------------------------------------     Tetrapisi...
EDO18651               --------------------------------------------------------------------------------     Vanderwal...
EJT44742               --------------------------------------------------------------------------------     Saccharom...
XP_003957222           --------------------------------------------------------------------------------     Kazachsta...
WGS:AEVR:RTG_01316 246 ekreerteeqavaNGDAQKEeKREDKGYEVDGSAEAEGEKVEVNgvgddhtleekqelateqEDAKPAVPEKSKAELWNS 325 Rhodotoru...
Q759H4             100 -------------KRAGEDDeQGSGGHASAGEGSVSSTVA-------------------------------RSKAELWQE 135 Eremothec...
XP_002553645       113 -------------KEDGEQDgLSSGMSTSLTDAQAPRASFAGQDpt------------------------aKTKAELWNE 155 Lachancea...
O94227             112 -------------GNELENEgLSSGMSAMTPAPSVSAKSPQSADtt------------------sVSETSTKSKAELWDD 160 Kluyverom...
XP_002496885       107 ------------mGNRASDDgISSGISTSVTSNGAPGSLQGGGEt--------------------------RSKAELWNE 148 Zygosacch...
CCE92499           110 ----------gnkGKLSDNDaLSSGISTSVTEVENLSASTASK----------------------VENKTQKSKAELWNE 157 Torulaspo...
CCE62858           115 -------------NATVEDGnVAGTSGSSIPGGTISEVTVDTNLppynlt-------lgdsqLESSEKYADFTKAQLWHE 174 Tetrapisi...
EDO18651           104 -------------SNRTVQDsVSTNADTATGGSIANIDTAQSDLvlvp-------------sailDDRINQMSKADLWNE 157 Vanderwal...
EJT44742           132 -------------NHTTREKsVKSIESSPL-----------------------------------------KTKAELWNE 157 Saccharom...
XP_003957222       104 -------------NYNGNSDtMSYSTATAVGSDVPAT----------------------------------KTKAELWSD 136 Kazachsta...
WGS:AEVR:RTG_01316 326 IKLLSFTRLFTSIYLLVLLSLQTHVQLALLGRSAYIESLLSTLPPRSpspsssarllpespsNPPPALADDAaqdddle- 404 Rhodotoru...
Q759H4             136 LKMRSAVKLLAVVYTTCMLLLLTRLQLNILARREYLETAIRVAKGEEatrr-------daagWLGAVWEYGAaalgalgp 208 Eremothec...
XP_002553645       156 LKLKSLTKLCTVIYSTSSLLLLTRLQLNILARREYIETAVKVAVDKEssqs-------siagWLANWWHAETwaavqede 228 Lachancea...
O94227             161 LKLKAITKIIILSYTTSLLMLLTRLQLNILARREYLDTAINSAMEKErekkan---qysvlsWFSSWITEKSnnlpseka 237 Kluyverom...
XP_002496885       149 LKTKSIVKLVTVAYTVSSLLLLTRLQLNILTRREYLETAVKMAVEKEgkde-------glsnWFKSIWTDAHanssns-- 219 Zygosacch...
CCE92499           158 LKTKSLIKMVTVSYTISSLLLLTRLQLNILTRREYLETAIKVAVEKEsgkteg----rslvnWVWGLWKYEDesvkldk- 232 Torulaspo...
CCE62858           175 LQLKSLVKLITISYTISSLFLLTRLQLNILTRREYLATAVNIAIEQEnakqknnsisnsvfnWFSGFIYKSPddnkdkl- 253 Tetrapisi...
EDO18651           158 LKLKSLVKLILISYSIPSLLLLTRLQLNILTRREYLETAVNVAIENEskksng---lsslfsWIGDWISQSDsnidna-- 232 Vanderwal...
EJT44742           158 LELKSLIKLTTVTYTVSSLILLTRLQLNILTRNEYLDSAIKLTMEQEnsnkln----srlynWVTSWWSNPEekmsd--- 230 Saccharom...
XP_003957222       137 LKVKSLIKVVTTSYVMSSLLLLAKLQLNMLTRREYLDTALRSQRIENqksnn-----ssflqWVTSTIISSVrisd---- 207 Kazachsta...
WGS:AEVR:RTG_01316 405 ---------salyaakSLPPTPAEARKDLERKYLTFSWWLLHEGWKVVWRRVEGAVEEVVGPMGLKTPLVYGELGALFAQ 475 Rhodotoru...
Q759H4             209 ---------rpavtavEPVDQHEETRYVNEQAFLSLSWWLLNRGWLQFKPLIERQVEQQFGTLSPRDTLSMEQFSARLSN 279 Eremothec...
XP_002553645       229 k-------epegpelsEKAQQARRSSYINEQAFLSFSWWLLNRGWLQFKSLAENLVERHFGDLNPRDMLTVEEFGGRLSS 301 Lachancea...
O94227             238 dprnsdgtidtdtrsiASTANPEKSRYVNEQAFLSLSWWLLNRGYLQYKSIIEQLVKEEFQNSNPRDIMTMDEFSGKISK 317 Kluyverom...
XP_002496885       220 -----------ssttsSSSSGNSKASYINEQAFLSLSWWLLNRGWLEYEAVAQESVESEFGSLSPRDTLSLEEFGNRLTN 288 Zygosacch...
CCE92499           233 ----------tfgeskPKVSSASKNSYINEQAFLSLSWWLLNRGWLEFQTIVEESVDKEFSSLNPRDTLTLQEFSDKLTQ 302 Torulaspo...
CCE62858           254 ---------ssegeniEAADSKTKLMYINEQAFLSTSWWILNNGYLVFSELATRKVDEYFSNYNPKDTLSLMEFSNNMSN 324 Tetrapisi...
EDO18651           233 -----------rdltkLKETPKSISTYTNEQAFLSLSWWLINKGWLDCTEIIEEHVNKEFGDLKPKDSITLTELSNRLTK 301 Vanderwal...
EJT44742           231 ------------ataaKDTKMDGQEVYINEQAFLSLSWWILNKGWLHYNEIITNQIEIEFSGVNPRDTLTLEEFSSRLTK 298 Saccharom...
XP_003957222       208 ------------ndleDDTNKVDQVTYINEQAFLSLSWWLLNRGWLKYRSIVEREIDAQFKDLGPKDVLTLKEFSTKLNE 275 Kazachsta...
WGS:AEVR:RTG_01316 476 IRRRIEQDADG-------------KLFDFSP----ALHPpTQDLEIQTLIAGGSYtppsssspthlsadpITPSLRSLLN 538 Rhodotoru...
Q759H4             280 TIHAVNRELFDs-----------dSRALLLR----ALLP-DATEELHVLQQTLDEgslr-------vierDDSMLRELLQ 336 Eremothec...
XP_002553645       302 VLHAINQELLVkt----------dAEQALQM----ILLP-DPNLEQFVLQQTLDSealk-------llyeDNTVLRQLLN 359 Lachancea...
O94227             318 IFVTTNKQFFQqp----------qSNEMFIS----CLLP-EPNLERFVLQQTLEQdalk-------vlyeDNLLLKQLVQ 375 Kluyverom...
XP_002496885       289 VFVNVNERIL--------------KSSKLQQ----ALLP-SRQMELFVLQQTLDPealg-------vvqrDSTILSQLLN 342 Zygosacch...
CCE92499           303 VFHHTNEKLLLspke------gsnEESRLRH----ILLP-SAALEGFVLQQTLDPealn-------ilseDRTILGQLIY 364 Torulaspo...
CCE62858           325 IFHSINKELFTnni-------seiETSQPINnisdIFLPeDSKID-YMLQRTMDEnslk-------elssDSLILSQLLS 389 Tetrapisi...
EDO18651           302 IYHSINKQLLNpsgtndlqedptqIKNRIGS----ILLP-DAASKNFVLQQTMDQdald-------ilneDSKVLDQLIT 369 Vanderwal...
EJT44742           299 IFQNINSQIFQe------------NNDSLLS----IFLPkTSSEQEFLLSQTLDPeale-------sfhtNTLIFKQLIN 355 Saccharom...
XP_003957222       276 VFYKINLE----------------TLDGLSN----ILLPeEKLES-FVLQQTLDSgsfnv------langQNIVLKRLIN 328 Kazachsta...
WGS:AEVR:RTG_01316 539 ETSDALDSSDAALVRALSLDKLFSLALEKVEVAFRSSGGERGARFe------------DVTEKQARLASLLPVLTRLSAA 606 Rhodotoru...
Q759H4             337 ETCRCAESTASLIVLESLVNESFQFVMQQLETKVTKKLRKPATDApead------gaaDAPSQKFQVALYSVALKDCCQE 410 Eremothec...
XP_002553645       360 ETTKCIESTASLIVLESLVNDAYQFAMSLIADNVSKKSKQKIDQDn-----------sEASEPKFQMALFSITSKHCCDE 428 Lachancea...
O94227             376 ETNKCLQSPGTWIVLESLIDETFHTIMEQIEDNVNSKSKPKSNDDdtk--------vvDISKNSYQIALFSIATKDCTNE 447 Kluyverom...
XP_002496885       343 ETTQCIESTASAVVLESLINESFQYIMTQVESNTSTKKR---------------------SGQGYQIAVFSIACKDCCTS 401 Zygosacch...
CCE92499           365 ETTKCIESTVSSIVLESLINESFQYIMEQVESSVSKKKTRKNDDE-------------EPSDKKYQVAVYAISCKDCCND 431 Torulaspo...
CCE62858           390 ETAEYLNDKSSIISLELLLNESFQFIMNEIENSVLSKIKKSNKKVnnetvendatqesDIKNKKVQLALIAMAGKDCCTK 469 Tetrapisi...
EDO18651           370 ETSQYINNTQSLVVLESLINESFQYIMDNLEDKILKRNKGKDGSP-------------ANPDKKFQLALIAMSCKDCCHD 436 Vanderwal...
EJT44742           356 ELTQCIESTVTSIVLESLINESFHFIMNKVGAKTMAKKKPG-----------------QEDQQYYQMAVFTMSIKDCCQE 418 Saccharom...
XP_003957222       329 ETQNYLKSNVSKIIMEQLINESFQYIMNSTEDKIKSKK--------------------KESDGKNQIALISICLKDVCNE 388 Kazachsta...
WGS:AEVR:RTG_01316 607 KGDAqgavla------sgvngNEWVEALEDVRELREFAAVLYGS 644 Rhodotorula toruloides ATCC 204091
Q759H4             411 MLKNglv-----------smnNEYLQDLDAVPELDDLSASVYSN 443 Eremothecium gossypii ATCC 10895
XP_002553645       429 MLKSgiv-----------smnNLFLQRLDSITELDDLSASVYSN 461 Lachancea thermotolerans CBS 6340
O94227             448 MLKAglv-----------smnNKFLQKLHSISALDDLSACVYSN 480 Kluyveromyces lactis NRRL Y-1140
XP_002496885       402 VLKSgvv-----------smdNELLSRLDTCPQLEDLSASVYSN 434 Zygosaccharomyces rouxii
CCE92499           432 ILKSglv-----------smdNEFLARLDSVVILDDLSASVYSN 464 Torulaspora delbrueckii
CCE62858           470 MLINnndlvpfrnttstqtvkNEYLKRLDTVTSLNDLSASVYGK 513 Tetrapisispora phaffii CBS 4417
EDO18651           437 MLRAdps-----------saeNEYLIRINTLSTLDDLSASVYSN 469 Vanderwaltozyma polyspora DSM 70294
EJT44742           419 MLQTapgsa-------hgggvNEYLATLDSVQPLDDLSASVYSN 455 Saccharomyces kudriavzevii IFO 1802
XP_003957222       389 MLVNgnl-----------sinNAYLNQLNAINELNDLCVSVYSN 421 Kazachstania africana CBS 2517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap