Conserved Protein Domain Family
PDE6_gamma

?
pfam04868: PDE6_gamma 
Retinal cGMP phosphodiesterase, gamma subunit
Retinal rod and cone cGMP phosphodiesterases function as the effector enzymes in the vertebrate visual transduction cascade. This family represents the inhibitory gamma subunit, which is also expressed outside retinal tissues and has been shown to interact with the G-protein-coupled receptor kinase 2 signalling system to regulate the epidermal growth factor- and thrombin-dependent stimulation of p42/p44 mitogen-activated protein kinase in human embryonic kidney 293 cells.
Statistics
?
PSSM-Id: 398504
Aligned: 4 rows
Threshold Bit Score: 125.029
Threshold Setting Gi: 597754928
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q502C6        5 KPKSTSKGATRATGPGSPHKGPPKFKQRSTRQFKSKPPKKGVIGFGEEIPGMEGLGTDFNVICPWEAYSHLELHELAQYG 84  zebrafish
XP_007239258  5 PASSALAAPAGGAGPTTPKKGPPKFKQRQTRTFKSKAPKPGQKGFGDDIPGMEGLGTDFTVVCPWEAFGDMELSDLAKYG 84  Mexican tetra
XP_018893820  2 SDNTTLAAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFG 81  western lowland ...
NP_001016745  6 PASSALAPVNNSGGPTTPRKGPPKFKQRATRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELAQFG 85  tropical clawed ...
Q502C6       85 II 86  zebrafish
XP_007239258 85 II 86  Mexican tetra
XP_018893820 82 II 83  western lowland gorilla
NP_001016745 86 II 87  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap