3VSM


Conserved Protein Domain Family
Baculo_E66

?
pfam04850: Baculo_E66 
Baculovirus E66 occlusion-derived virus envelope protein
Statistics
?
PSSM-Id: 398491
Aligned: 3 rows
Threshold Bit Score: 726.041
Threshold Setting Gi: 82011939
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VSM_A 272 EVINTVGLTRAIENVGSPEGVVVPGVMSRNGTLYSNVIGNFITYPLAVHSADYSKVLTKLSKTYYGSVVGVTNRLAYYES 351
Q91F16 302 DVLNDEGLTRSIQNVASPEGIVNPAVMSRNGTLFSNVIGAFVQYPITVHSADHSKVLTKLSNMYYGCVVGTTPRLAYYEA 381 Cydia pomonella granu...
Q8B9K4 314 EVINTVGLTRAIENVGSPEGVVVPGVMSRNGTLYSNVIGNFITYPLAVHSADYSKVLTKLSKTYYGSVVGVTNRLAYYES 393 Rachiplusia ou MNPV
3VSM_A 352 DPTNNIQAPLWTMARRIWNRRGRIINYNANTVSFESGIILQSLNGIMRIPSGTTSTQSFRPTIGQTAIAKTDTAGAILVY 431
Q91F16 382 DPTNNVQGPLWAMNRRIWNRSKPVINYTVNSVLFESGVLCQTPNGLLPVPSTTTSTQSFRPQIGETAIVKTNNTGAMLSH 461 Cydia pomonella granu...
Q8B9K4 394 DPTNNIQAPLWTMARRIWNRRGRIINYNANTVSFESGIILQSLNGIMRIPSGTTSTQSFRPAIGQTAIAKTDTAGAILVY 473 Rachiplusia ou MNPV
3VSM_A 432 AKFAEMNNLQFKSCTLFYDHGMFQLYYNIGVEPNSLNNTNGRVIVLSRDTSVNTNDLSFEAQRINNNNSSEGTTFNGVVC 511
Q91F16 462 SLFAELNDLQFVSCTLYYDEGMFQLYYNMGVREGVLGNNNGRVVVLARDTAVSTPDATFAQQREDNGNTSDGTVYNGVVC 541 Cydia pomonella granu...
Q8B9K4 474 AKFAEMNNLQFKSCTLFYDHGMFQLYYNIGVEPNSLNSTNGRVVVLSRDTSVNTNDLSFETQRINNNNSSEGTTFNGVVC 553 Rachiplusia ou MNPV
3VSM_A 512 HRVPITNINVPSLTVRSPNSsVELVEQIISFQTMYTATASACYKLNVEGHSDSLRAFRVnsDENIYVNVGNGVKALFNYP 591
Q91F16 542 YRVPITGLSVPSLSTRVQGS-VEIVEQVIGFDALHNKEGVCSYKLNVEGMADNLKVYML--EVGVLYAVANHTKALFRYP 618 Cydia pomonella granu...
Q8B9K4 554 HRVPITNMNVPSLTVRSPNSnVELVEQIISFQTMYTATASACYKLNVEGHSDSLRAFRVnsDENIYVNVNNGVKALFNYP 633 Rachiplusia ou MNPV
3VSM_A 592 WVMVKENNKVSFMSANEDTTIP---FSVIMNSFTSIGepalQYSPSNCfVYGNG-FKLNNSTFdLQFIFEI 658
Q91F16 619 YVALKDGDRLAVSSVEESLVLSeevLNVIKNDIQERG----ATTPVNC-VYNSGvYTLTNNNY-LQFWFDY 683 Cydia pomonella granulovirus
Q8B9K4 634 WVMVKENNKVSFMSANEDTTIP---FSVIMNSFTSIGepalQYSPSNCfVYGNG-FRLNNSTFdLQFIFEI 700 Rachiplusia ou MNPV
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap