2KT9


Conserved Protein Domain Family
PSRP-3_Ycf65

?
pfam04839: PSRP-3_Ycf65 
Click on image for an interactive view with Cn3D
Plastid and cyanobacterial ribosomal protein (PSRP-3 / Ycf65)
This small acidic protein is found in 30S ribosomal subunit of cyanobacteria and plant plastids. In plants it has been named plastid-specific ribosomal protein 3 (PSRP-3), and in cyanobacteria it is named Ycf65. Plastid-specific ribosomal proteins may mediate the effects of nuclear factors on plastid translation. The acidic PSRPs are thought to contribute to protein-protein interactions in the 30S subunit, and are not thought to bind RNA.
Statistics
?
PSSM-Id: 398487
Aligned: 16 rows
Threshold Bit Score: 80.097
Threshold Setting Gi: 270118644
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KT9_A            36 LTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQD 82  Synechocystis sp. PCC 6803
jgi:Mic7113_2749  30 LTSYFFWPRNDAWEQLKNELEAKHWISESDRIDLLNKATEVINYWQE 76  Microcoleus sp. PCC 7113
B1WYT6            40 LTAYFFWPRNDAWQELKDELEAKHWILETERIEILNKATEVINYWQD 86  Crocosphaera subtropica ATCC 51142
jgi:Cal6303_3057  45 LTKYFFWPRNDAWEEMKKELESKHWITDVDRVELLNKGTEVINYWQE 91  Calothrix sp. PCC 6303
WP_015219190      43 LTPYYFWPRTDAWQELKDELDTKTWITETEKIELLNQATEVINFWQE 89  Cyanobacterium aponinum
Q2JKV8            30 LTHYFFWPRDDAWEQLKAELESKTWISEVDRIELLNRATELINYWQN 76  Synechococcus sp. JA-2-3B'a(2-13)
EDP06886         230 LTEYYFWPRQDAWEELRINLESRPWISERDRIILLNRLTQLINFWQD 276 Chlamydomonas reinhardtii
EFN55722         121 VTEYFFWPRKDAWEELKASLDARTWIGEREKVLLLNQCTEVINFWQA 167 Chlorella variabilis
WP_015166520      26 LTKYFFWPRDDAWDQLKTEMESKPWISDQERIEMLNKATEVINYWQE 72  Pseudanabaena sp. PCC 7367
O05161            43 LTAYYFWPRHDAWEQLKTELESKSWITEAERVELLNQATEVINYWQE 89  Synechococcus elongatus PCC 7942 = FACHB-805
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap