Conserved Protein Domain Family
MbeB_N

?
pfam04837: MbeB_N 
MbeB-like, N-term conserved region
This family represents an N-terminal conserved region of MbeB/MobB proteins. These proteins are essential for specific plasmid transfer.
Statistics
?
PSSM-Id: 113603
View PSSM: pfam04837
Aligned: 9 rows
Threshold Bit Score: 57.8331
Threshold Setting Gi: 117269
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O52994         1 MSNLLQMGTDFEKKLKERAVSTENMLNSEFRKLEASVDRELKLNGQKIRDAI 52  Escherichia coli
EJE57942       1 MSNLLQTGAEFEKKLKERAESTEKMLNNEFRRLGESVSEAVTSNETKIRDAI 52  Escherichia coli O111:H8 str. CVM9634
O52170         1 MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAI 52  Salmonella enterica subsp. enterica serovar...
Q51607         1 MSSLLTLAKDLELKSKEQQQSTERMLKTVFSEHERSVRQELNESAKRISDAI 52  Plasmid ColA
Q9K590         1 MSEMSRLATAFEERSKEQAESTEKAVRSAFEKHESALLSALSESEKRTSDAI 52  Halomonas elongata
Q9RLF0         1 MSEILNLAREFESKSKQQAKTTATSVASAFEKHEKRITEALKLSSGNIQTAI 52  Plesiomonas shigelloides
P07049         1 MSKISDLAKTFEQTSRTEAASIEQQTKADLETLRKNINEALKQSEQKITADI 52  Neisseria gonorrhoeae
Q9EXK1         1 MSRILNLAQTFSESARQDSEIMTEKVKLAIEQHENDLKAQLADASRNLSESI 52  Proteus vulgaris
WP_010890208   1 MSKILDLAQTFQQTSQKELESTSEIVQNAIKRHEQNLIQQLQHAGNNLAENI 52  Pasteurellaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap