4XAL


Conserved Protein Domain Family
Herpes_UL49_2

?
pfam04823: Herpes_UL49_2 
Click on image for an interactive view with Cn3D
Herpesvirus UL49 tegument protein
Statistics
?
PSSM-Id: 398478
Aligned: 4 rows
Threshold Bit Score: 125.344
Threshold Setting Gi: 82005060
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4XAL_A  24 RKLHFSTAPPNPDAPWTPRVAGFNKRVFCAAVGRLAAMHARMAAVQLWDMSRPRTDEDLNELLGITTIRVTVCEGKNLLQ 103 Human alphaherpesviru...
Q6UDL8 140 KGFGPSATPASDSDRWRTTTNPANRSAFVQAVSVTAMAQGELAARAAWEKYKPRNNEDLEKLVETLEIKITVNPGRGLWD 219 Psittacid herpesvirus...
P09272 154 RPISFSTAPKTATSSWCGPTPSYNKRVFCEAVRRVAAMQAQKAAEAAWNSNPPRNNAELDRLLTGAVIRITVHEGLNLIQ 233 Human herpesvirus 3 s...
Q9E6M7  93 K-FAFSTAPSSASSTWRSNTVAFNQRMFCGAVATVAQYHAYQGALALWRQDPPRTNEELDAFLSRAVIKITIQEGPNLMG 171 Marek's disease herpe...
4XAL_A 104 RA 105 Human alphaherpesvirus 1 strain 17
Q6UDL8 220 VA 221 Psittacid herpesvirus 1 Amazon parrot/1997
P09272 234 AA 235 Human herpesvirus 3 strain Dumas
Q9E6M7 172 EA 173 Marek's disease herpesvirus type 1 strain MD5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap