Conserved Protein Domain Family
Umbravirus_LDM

?
pfam04817: Umbravirus_LDM 
Umbravirus long distance movement (LDM) family
The long distance movement protein of Umbraviruses mediates the movement of viral RNA through the phloem of infected plants.
Statistics
?
PSSM-Id: 113583
View PSSM: pfam04817
Aligned: 4 rows
Threshold Bit Score: 332.248
Threshold Setting Gi: 81971872
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9DX76   1 MASVVNVNLNSKSGLQTRTTGRPLRGGNYERTPGKQSRSSHPRQRKCAGNTHPAATPRHSKPAVQGTKEVPPHSPHRRNV 80  Tobacco mottle virus
Q9IM02  27 MSSVINVFASGKSCDSRGAPRSSVRGGHRTGAPRNKPGGTHTPSRRPKGGVHPATTSKDPNKNIRSPPAPTPHKEHRGPA 106 Groundnut rosette virus
Q9IM07  27 MSSIINVFASGKSRDTRGTPRSSVWRGHRTGAPRDKPWGAYTPSRRPKGGVHPATASKDPNENIRGPSASTTHQEHWGSV 106 Groundnut rosette virus
Q84695   7 MTIIINV-NNDERKQPEGATGSSVRRGDNKRTRGNKPRSHHPGSRERKGYNHPSPTPKNSKQGQLRTEAVQEHPKHGGTA 85  Pea enation mosaic vi...
Q9DX76  81 VHREGGYCFDAPRAGRLSRRGGGLHSRQPTPQSQLNGREGESRAQWRAEVDGLLSPLLDTIVGHGWNPTKVFLRGIQLGR 160 Tobacco mottle virus
Q9IM02 107 IPGENRGGVHTTRARRRARRSGGMDPRQLTAQPQQRWAETKIPTERRAAIDGLLPPLLNTLDGQIQGNAALLRYCVGAVK 186 Groundnut rosette virus
Q9IM07 107 VPGKSCGGVHTPRTGRRTRRSGSMDTRQSTAQPKQRGATAAIPPERRAKIDGLLPPLLDTFDGQIQGDAALLRYCVGALK 186 Groundnut rosette virus
Q84695  86 FRRESGGSVHPSHPRRRARRGGDMAPRQHPPPPRERRTKTETQAERRAQALSVLPTLLDCIGGLDLGPAEVLLHCHRAVR 165 Pea enation mosaic vi...
Q9DX76 161 VYTRNKRgEPILNVSDVAPKRGEQVSQLPATKPQITPSLPTQGPANATPIGPPAEVPQRRDVEQVCTTCDGN 232 Tobacco mottle virus
Q9IM02 187 RELRRRW-KPVQPAHHVAASSGKPSPQLSDEAARNAEDLSRDGEGRAGKSVQQEVLHSGSSVPEVCADCGKL 257 Groundnut rosette virus
Q9IM07 187 RELRRRR-KPVQLAHNVAASGGEPSSQLPDEAAKDAENLPGDGEGRAGKSVQQEVLHSGGSVPAVCADCGKP 257 Groundnut rosette virus
Q84695 166 RQLRTGV-QPIQPVPHVESTHRSSDPQLLESSTTCSANLQNDGAGRVIGGGIPTAIPEGSDVEQVCHASHYG 236 Pea enation mosaic virus 2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap