3EH2,5KYY,4BZI,1PD0,3EH1,5VNK


Conserved Protein Domain Family
Sec23_trunk

?
pfam04811: Sec23_trunk 
Click on image for an interactive view with Cn3D
Sec23/Sec24 trunk domain
COPII-coated vesicles carry proteins from the endoplasmic reticulum to the Golgi complex. This vesicular transport can be reconstituted by using three cytosolic components containing five proteins: the small GTPase Sar1p, the Sec23p/24p complex, and the Sec13p/Sec31p complex. This domain is known as the trunk domain and has an alpha/beta vWA fold and forms the dimer interface.
Statistics
?
PSSM-Id: 398467
Aligned: 21 rows
Threshold Bit Score: 244.853
Threshold Setting Gi: 74627049
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EH2_C  171 PSPPAFIFMIDVSYNairTGLVRLLCEELKSLL-DFLPreggaeeSAIRVGFVTYNKVLHFYNVKSSL-------AQPQM 242  human
Q9M081  502 PMPAVYFFLIDVSMNaiqTGATAAACNAIQQVL-SDLPe-----gPRTFVGIATFDSTIHFYNLKRAL-------QQPLM 568  thale cress
Q9VQ94  599 PEVPAFIFIIDVSYNtvkSGLVHLLCSQIKNIL-KHLPvdqgqdkSKVRVGFITYNSTVHFYNIKSSL-------AQPQM 670  fruit fly
Q19371  531 PKEPAFIFMIDVSYNaisNGMLPILCQNLEKVL-RNLPresgqleSSMRIGLATFDQAVHFFDISS---------ASPKM 600  Caenorhabditis elegans
Q9USS7  289 PKPARFVFMIDVSYEassKGLPKVAAEAIRNILyGPVPl-----dPNVKIAIVCFDRSVNFFNLSPNL-------EQPHM 356  Schizosaccharomyces...
Q9SFU0  443 PMPPIYFFLIDVSISatkSGMLEVVAQTIKSCL-DNLPg-----yPRTQIGFITYDSTLHFYNMKSSL-------SQPQM 509  thale cress
1PD0_A  185 PPPATYCFLIDVSQSsikSGLLATTINTLLQNL-DSIPnh----dERTRISILCVDNAIHYFKIPLDSenneesaDQINM 259  baker's yeast
Q9UUI5  327 PQPLVYVFLIDISFVsisSGMVGTASRAILESL-DRIPnk----eGRAKVAFIGVDSALHFFSVSPGA-------EEATQ 394  Schizosaccharomyces...
Q23368  403 PQPAVYVFVIDISAAaiqSGYLHTFAEQLLINI-DQMPg-----dDRSQVCFIAVDQCLHFFSFSSNK-------RYPNE 469  Caenorhabditis elegans
3EH1_A  158 PQPAVYLFVLDVSHNaveAGYLTILCQSLLENL-DKLPg-----dSRTRIGFMTFDSTIHFYNLQEGL-------SQPQM 224  human
3EH2_C  243 MVVSDVADMFVPLLDGFLVNVNESRAVITSLLDQIPEMFADT--RETETVFVPVIQAGMEALKaaECAGKLFLFHTSLPI 320  human
Q9M081  569 LIVPDVQDVYTPLETDVVVQLSECRQHLELLLDSIPTMFQES--KIPESAFGAAVKAAFLAMK--SKGGKLMVFQSILCS 644  thale cress
Q9VQ94  671 MVVGDVQEMFMPLLDGFLCHPEESAAVIDALMEEIPRMFADT--KETETILYPAIQAGLEALKasNAAGKLLVFNSTLPI 748  fruit fly
Q19371  601 LVMSDVQEPFVPMVDGLLLPYNEALPGLRAALAEIPKLFSQS--KTTETILQPVVQAGLDALKcaDRAGKVILFSTVLPT 678  Caenorhabditis elegans
Q9USS7  357 LAASDLENPFVPFSSGLFVDPIASKVVIERLLDSFPAIFQDV--KIPEPVVGNALEVVKLLLK--ETGGKAFVFVSALPT 432  Schizosaccharomyces...
Q9SFU0  510 MVVSDLDDIFVPLPDDLLVNLSESRTVVDAFLDSLPLMFQDN--FNVESAFGPALRAAFMVMN--QLGGKLLIFQNSLPS 585  thale cress
1PD0_A  260 MDIADLEEPFLPRPNSMVVSLKACRQNIETLLTKIPQIFQSN--LITNFALGPALKSAYHLIGgvG--GKIIVVSGTLPN 335  baker's yeast
Q9UUI5  395 LVVSDLEEPFLPRNQDLLLNLRECRQGIENLLERFQSMFATT--RDSSNALGPGLKAAHRLIEniG--GKICCLISSLPN 470  Schizosaccharomyces...
Q23368  470 MIVDDIDDAFLPSVTSLLVPMKKFKDTIRTFIKQLPEFYSQIgpTSNGNCLGSALKLAQSMIQ--EVGGRISIFQVSLPN 547  Caenorhabditis elegans
3EH1_A  225 LIVSDIDDVFLPTPDSLLVNLYESKELIKDLLNALPNMFTNT--RETHSALGPALQAAFKLMS--PTGGRVSVFQTQLPS 300  human
3EH2_C  321 AEApGKLKNR-DDR---KLINTDKEKTLFQPQTG-AYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKY 395  human
Q9M081  645 VGV-GALSSR-EAEgraNMSAGEKEAHKLLQPADkTLKTMAIEFAEYQVCVDIFITTQAYVDMASISVIPRTTGGQVYCY 722  thale cress
Q9VQ94  749 AEApGKLKNR-DDR---KLLGTDKEKTVLTPQTT-AYNTLGQECVQQGCSVDLFVFNNAYIDLATIGQVSRLTGGEVFKY 823  fruit fly
Q19371  679 YDApGKLKSK-NDR---SLLGTDKEKNALVPQED-SYTKLGEQCVKSGVTVDLFLFPNAFIDVATIGQLSAVTGGSIFKF 753  Caenorhabditis elegans
Q9USS7  433 MGL-GKLRHR-EDQ---RLYGTSDE-KNLWNTQDkWYTSLADEYVTAGIGVDIFFTATAYVDVATVGSVATLSGGQIYHY 506  Schizosaccharomyces...
Q9SFU0  586 LGA-GRLKLRgDDP---RVYGTDKE-YALRVAEDpFYKQMAADCTKFQIGINVYAFSDKYTDIASLGTLAKYTGGQVYYY 660  thale cress
1PD0_A  336 LGI-GKLQRR-NES---GVVNTSKETAQLLSCQDsFYKNFTIDCSKVQITVDLFLASEDYMDVASLSNLSRFTAGQTHFY 410  baker's yeast
Q9UUI5  471 VGV-GKLELR-EDP---KLLGTNRE-SSLLHPNDsFYKSFAVECSTSQVSVDMFLFSSQYQDVATLSCLPRYTSGKTQFY 544  Schizosaccharomyces...
Q23368  548 LGL-GALKSR-EES---TEGG-----QNLGPATD-FYKALSLECTGSQICLDLFMFNTQYADLATLSEIAKFSTGCVYHF 616  Caenorhabditis elegans
3EH1_A  301 LGA-GLLQSR-EDP---NQRSSTKVVQHLGPATD-FYKKLALDCSGQQTAVDLFLLSSQYSDLASLACMSKYSAGCIYYY 374  human
3EH2_C  396 ASFQve---ndQERFLSDLRRDV 415  human
Q9M081  723 YPFSal---sdPPKLYNDLKWNI 742  thale cress
Q9VQ94  824 TYFQad---vdGKRLIQDIIKNV 843  fruit fly
Q19371  754 QYFSad---kdGVRMLNELERHV 773  Caenorhabditis elegans
Q9USS7  507 SNFVad---rdGSRLKQDLFRSV 526  Schizosaccharomyces pombe 972h-
Q9SFU0  661 PGFQss---vhGDKLRHELARDL 680  thale cress
1PD0_A  411 PGFSgkn-pndIVKFSTEFAKHI 432  baker's yeast
Q9UUI5  545 HRWNasr-sedALKFASELTNYL 566  Schizosaccharomyces pombe 972h-
Q23368  617 PNYNyrndihqVKRFERTLTRYL 639  Caenorhabditis elegans
3EH1_A  375 PSFHythnpsqAEKLQKDLKRYL 397  human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap