3SB1


Conserved Protein Domain Family
HupH_C

?
pfam04809: HupH_C 
Click on image for an interactive view with Cn3D
HupH hydrogenase expression protein, C-terminal conserved region
This family represents a C-terminal conserved region found in these bacterial proteins necessary for hydrogenase synthesis. Their precise function is unknown.
Statistics
?
PSSM-Id: 398465
Aligned: 47 rows
Threshold Bit Score: 125.344
Threshold Setting Gi: 512179431
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SB1_A             45 NALPLLREIAEHLHHLLETGEASTIDLSALPLTPGDLEWLRAELGGGEVSVTLHADGA-STLDETAFPGVWWIIHRNAQG 123 Thiobacill...
jgi:HY04AAS1_0045   4 NAVPILYEIQKALEDFVKTGQNHIIYTNKIPLSEEDKEFLLDVLGEGSIKIEYKSKREyITFKETSLIGVWLGVVYDVER 83  Hydrogenob...
O66900              4 NAIPILKEILQALKDLYEKGEEHVIYINKLPITPEDRELLLDVLGEGQVKITYSSKTQpAEWKETGIFGVWIGIIKNRDD 83  Aquifex ae...
jgi:Thal_1104       2 NAPYLLKEILDALKDLVEKGEEHTIYINKIPITEEDRIAILDVLGEGQITIRMESTTYpVEWRETGISGVWIGVFFDREK 81  Thermocrin...
WP_012607667       16 NAPALLQEIAAALDVLLLSGRRHCIDLGSLPLSPADRDLLRETLGTGEIRMELEALGN-SRIEETGVPGVWWVRHSSEDG 94  Acidithiob...
jgi:Thimo_3344     17 aAKAILHQVRLALGHLADTGETAQIDLRAQPLAPGDLERLLAWLGRGEVEATVTALGP-TRVWESAVPGVWLVDHRDADD 95  Thioflavic...
WP_012971234       26 hALPILHEIRHALERLLASGEETRIDLHSMPFGPGDLERLTAVLGSGEVQARVEALGP-TLIQETAIPGVWLVDYRGLED 104 Allochroma...
jgi:Thivi_2697     23 htLPILHEIRHALERLLATGEETRIDLNAMPFGPGDLERLRAWLGTGEVQASVSAMGL-TLIQETAIPGVWLVDYQNADS 101 Thiocystis...
WP_012637839       25 mADALLREIHAHLVNLHERSESHTIDLKGLPLTEADRRQLREALGRGEVSMTVEAAGP-TEAYETAYGGVWWIDYQNLLG 103 Thioalkali...
WP_015258838       22 mALALLREIADHLSTVVGGGERQVVELGNLPLSEVDRELLRERLGRGEVEAKILASGL-TEVYETAFPGVWWVKYFHDGD 100 Thioalkali...
3SB1_A            124 AVTTQFIEVAFVPELVKSPRADVAAARAAL 153 Thiobacillus denitrificans ATCC 25259
jgi:HY04AAS1_0045  84 KPILEILEINSFPFMLQAPKEDIEDSIKRL 113 Hydrogenobaculum sp. Y04AAS1
O66900             84 KPVLETIEITYFPKLASAQKEDVQESIKYL 113 Aquifex aeolicus
jgi:Thal_1104      82 KPILETIEVTTFPKLAAAQKEDILESIRKL 111 Thermocrinis albus DSM 14484
WP_012607667       95 ILLTESLEVCHVPEIVPADTTDIAIGLRRL 124 Acidithiobacillus ferrooxidans
jgi:Thimo_3344     96 ERLTLQIEVAPFPDILRSPPQDIEQAVATL 125 Thioflavicoccus mobilis 8321
WP_012971234      105 QRLSYQIEIAAIPEILRPRPEDLAESLGAL 134 Allochromatium vinosum
jgi:Thivi_2697    102 QRLTLHLEIAPVPEILRPQPQDLAEAIATL 131 Thiocystis violascens DSM 198
WP_012637839      104 STALTHIEIARVPAIAPTHPEDIADALERL 133 Thioalkalivibrio sulfidiphilus
WP_015258838      101 HYVAEQIEIGAVPMILETHAEDIRASAERF 130 Thioalkalivibrio nitratireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap