Conserved Protein Domain Family

pfam04807: Gemini_AC4_5 
Geminivirus AC4/5 conserved region
PSSM-Id: 147122
Aligned: 11 rows
Threshold Bit Score: 45.0916
Threshold Setting Gi: 81979857
Created: 11-May-2020
Updated: 7-Aug-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q9Q1R7  51 KIVLNCRSAGLVVEHIKNLSEVHWTGpIWTTVTN 84  Watermelon chlorotic stunt virus-[IR]
Q9WB29  12 MHILHRCSAWFIVEHIKNLPKVLWSS-CRTTVSN 44  Squash leaf curl China virus
Q88536   1 MHVLHRCCARFIVKHIKHFPEILGRS-CRTTVTN 33  Tomato leaf curl New Delhi virus-Severe
Q9IZ50  64 MHVLHGRRTGLIIKHIKYFTKILWFI-YRSSITN 96  Bhendi yellow vein mosaic virus-[Madurai]
Q08591  12 MHVLHGSCTGLIIKHIKYFTKILRLI-NRPTIPY 44  Indian cassava mosaic virus
Q76WK9  51 KIVLHSSSTGFIVIHVEHLTKVLWRA-KWTSVTH 83  Mungbean yellow mosaic virus
Q9WH21  51 QIVLHSGCTGLVVIHVEHLTKIHGCT-KWSSVTT 83  Mungbean yellow mosaic India virus
Q67580  51 KIVLDRSSTRFIVKHVKNLTKIHRGS-IWSTVTD 83  Bean golden yellow mosaic virus-[Puerto Rico-Japan]
Q9YNW8  51 EIVLHRRSARLVVEHVEHLTEIHRSA-IGSTVPD 83  Sida golden mosaic Florida virus-USA
Q9E004  51 EIVFHSGGARLVVEHVKHLAKVHRGT-IRSTVPD 83  Tomato rugose mosaic virus-[Ube]
Q9YNW2  37 EIVLNRGGARLVVIHVKHLAKVHWSA-IGSTIPD 69  Sida golden yellow vein virus-[A11]
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap