4CPC


Conserved Protein Domain Family
Cor1

?
pfam04803: Cor1 
Cor1/Xlr/Xmr conserved region
Cor1 is a component of the chromosome core in the meiotic prophase chromosomes. Xlr is a lymphoid cell specific protein. Xlm is abundantly transcribed in testis in a tissue-specific and developmentally regulated manner. The protein is located in the nuclei of spermatocytes, early in the prophase of the first meiotic division, and later becomes concentrated in the XY nuclear subregion where it is in particular associated with the axes of sex chromosomes.
Statistics
?
PSSM-Id: 398463
Aligned: 40 rows
Threshold Bit Score: 92.6792
Threshold Setting Gi: 29336758
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4CPC_A         20 KALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQ 99  
NP_001119789   76 ESHLAKKKQFCQDVVTSVKRLSEKLVSIYKRQKRERTMFHSNYSKSLQSLFQQWDMSVEKVGQEEDSFINSSHQHEKIIY 155  house mouse
XP_002591784 1371 KKKQHMKKQLDSFSRNTLKSTQKEVKGLWKGQMGRRMRVQEDFKGNLLHELDFLEKEMANLQACEEKALKFFENQQKLLS 1450 Florida lancelet
5_pfamImport    1 KSVSLKRKKLEAFTKQCC-AAADRFENVFEIQKRDRGALNEEYTKQVSSVIKQWEADIDKAKENEEKLTNLLTQQMKLIT 79  
XP_002125203   77 KSISSKRRKLEAFTKQCC-AAREKLDSVLENQKKDRSTLNEEYKKQISSVINQWETDIDKAKENEEKLNNLLTQQMKLIT 155  vase tunicate
EDV21935       16 KSLNVKQKLLEEFTLSSLSSSKKKVEETWIAHRRDRKELTENFEATVSNIMNSWKEEIQDSKRFEDKVHALLQQHQELLM 95   Trichoplax ad...
XP_003387517   77 KTIQNKKRKIETFTKESLEYSKRKMKEVNTKQSADRQVVLNSYTKQVDVILGQWEEDLGKMKEGEEKLSLVMKQFQTQSR 156  Amphimedon qu...
XP_001635206   21 NTLNAKRKRIQSFSQASLKASSRKFDEVWRKQQNERSAQYEEFSKQVLLVLGQWEADLQKTREAEEKLESMYKQQQKLFN 100  starlet sea a...
EKC40091       80 KTLVNKRKRLEQYTQNSLKSSTKKVEDIWKMQQTERQKLQDEYVRQVGTVFQQWESDLEKAKEQEEKLNQMFKQQQKMFQ 159  Pacific oyster
XP_002590403   89 KTLSAKRKRLEMFTHSAVKASNHKVENTWMAQHSERMKLSSEYQTQVQTVMNQWDSDIQKFKEQEEKLQNLFKQQQKLFQ 168  Florida lancelet
4CPC_A        100 QSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKK 151 
NP_001119789  156 NTMMAQKATIDQAKAISDQFLKNIQELEEKHKLLDALEQNRLENEMKNLKKK 207  house mouse
XP_002591784 1451 TARITHEQRFRKIMHMEEDFHKTLTQLDREQEQ----QQISLRESLCAKQQD 1498 Florida lancelet
5_pfamImport   80 QVRVVQTQRFKSIKQLHEQYMKSVGTVDETHSEQNRDVNKEIEKELTGLQKK 131 
XP_002125203  156 QVRVVQTQRFKSIKQLHDQYIKSVGTVNETHSQQHKDVNKEIDKELSNLQKK 207  vase tunicate
EDV21935       96 EVRNLHAKYLTHLHESCKMYVDSISSIDERYEKRLASAHCAIKKEAQGLKKK 147  Trichoplax adhaerens
XP_003387517  157 QQRLAMLQKYKTMKQLKDEFAKSIDQLQETHDKQLSSIHDEMKEEMAQLRKK 208  Amphimedon queenslandica
XP_001635206  101 QQRIVQTQRLKRVQQLHEDYGKSLKELRKTHEDQQSSVQEQLRKEISGLQKK 152  starlet sea anemone
EKC40091      160 QARVVQSQRLKTIKQLHDQFTKGIDELERCHHDQQSSVQSELKKEMSLLQKR 211  Pacific oyster
XP_002590403  169 QQRVIQSQRLKTLRQLHDQYTKGMDELEHCHQDQQGSMQVELRKEMALLQKK 220  Florida lancelet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap