Conserved Protein Domain Family
Fzo_mitofusin

?
pfam04799: Fzo_mitofusin 
fzo-like conserved region
Family of putative transmembrane GTPase. The fzo protein is a mediator of mitochondrial fusion. This conserved region is also found in the human mitofusin protein.
Statistics
?
PSSM-Id: 398459
Aligned: 25 rows
Threshold Bit Score: 190.181
Threshold Setting Gi: 47605567
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009027995 576 DDnELMVSLLSAFSSLYSGTTIGVLAIAALLGKAAGWRVIGLCGGIYGLLYLYERITWTNSAKEKAFKRQYVDYASGKLR 655 Helobdella robusta
XP_003243736 602 EQ-NLSMISRVVAASVGTQGTVGGLVLAGFMLKTVGWRLIVAAGAVYGVLYLYERLSWTTKAKEREFKRQYVDHATAKLR 680 pea aphid
XP_002432275 592 SN-DWSLISRMAMASVSSQGTMGVLLLTGFMMRTVGWKVILVTGALYGCVYFYERLTWTNKAKEKTFKKQYVNHATKKLR 670 human body louse
Q7PY95       618 NE-QLSVISKVAIASIGSQGTLG-LVVAGLMLKTIGWRVIVGAGVIYGSVYLYERLSWTNTAKERNFKNQYVDHATRKLK 695 Anopheles gambi...
XP_002009525 646 PE-QLSVISRFALSSIGSQGTVGGLVVAGIMLKTIGWRVLVGIGALYGCIYLYERLSWTNSAKERAFKSQYVRHATKKLK 724 Drosophila moja...
XP_004365821 717 AEaALTLADRVGLVLSTPSSYAVVTILATLVTRPGVWKLAALSGAAFGSLYLYEYALYTNGAKERRFKEQFTRHAASELR 796 Capsaspora owcz...
O18412       563 NHwQMLESL------VKSKGSLGTVLLSAMAIRSFNWPIVLILGGLVGSFYIYEYAAWTTAAQERSFKSQYARLLQQRLR 636 fruit fly
CRZ23693     611 QEnAMMAQLILSSIGYVANGSLGLLVIGGIVSKAISWRFIAAGIALYGGLYAAEYWRWNSGAKEQHLKDQFRHHLNARMR 690 Brugia malayi
XP_794912    583 SA-DMTVAMLSGIASLYSRTSVGLMIISGIVWKSVGWRVLVVGGGLYGVVYAYERLTWTNRAKERIFKKQFVEYASDKLK 661 purple sea urchin
KAE9438545   106 PE-DWSLTSRLALASVGSQGTMGGLLLAGMMLKTVGWRIIAVTSALYGCLYLYERLTWTNKAKEREFKRQYVDHATKKLK 184 Apolygus lucorum
XP_009027995 656 LIVDLTSANCSHQVQQELNSTFGRLCQQVEMTKNDLEDELKNLEVEITKLDEASKQAICLKNKTQFVDTELSNFMLQYLK 735 Helobdella robusta
XP_003243736 681 LIVDLTSANCSHQVQQELSTTFARLCQLVDESATNLNDEMKNLDRELNMLTKSTEIAKILRNKADLLKVELKQFDDTFLc 760 pea aphid
XP_002432275 671 MIVDLTSANCSHQVQQELSSTFARLCHLVDESTTEMTKQIKDLDKELKELDEAGNRAKVLRNKANYVLNELDIFEEKFLK 750 human body louse
Q7PY95       696 LIVDLTSANCSHQVQQELSSTFARLCRVVDTASTEMNEELKQIESSLGVIETNQKQIKLLKNKANYIMNELEIFDSNYIK 775 Anopheles gambi...
XP_002009525 725 MIVDLTSANCSHQVQQELSSTFARLCRTVDTATTDMNEELKTLEAQLNVLESNQKQLKLLRNKANYIQNELDIFEHNYIA 804 Drosophila moja...
XP_004365821 797 RSVRQTSHTVSISLQSRLSFYVDELRNAVRQTEATLTAEIARAEREVAMMQDAISKAGLLHHEALSIRKGLADAQETFID 876 Capsaspora owcz...
O18412       637 SDVQQTVSGFELQLRQHLATVRNCWEAQSNETLNDLNVRTAELTKQIQSMEVLQLSLKKFRDKGQLLASRLGDFQETYLT 716 fruit fly
CRZ23693     691 SVATTHTLHCETQVLREMQQVLGGLKSTVGGVHQEMKTELDNMRREIEKIDHVTKGLNTIKGKASFLNTDLDRFENEFLK 770 Brugia malayi
XP_794912    662 LLVSFTSSNLSHQIQQELSGTFARLSLEVETSKQSLEKEIVDMEVETKRLEGLITKAKLMRNKAGWLDNELERFIKQYIL 741 purple sea urchin
KAE9438545   185 LIVDLTSANCSHQVQQELSSTFARLCHLVDESTTDMAQEMKELEKELKSLEEAANSAKVLRNKASYLAKELDMFDEVYLK 264 Apolygus lucorum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap