Conserved Protein Domain Family
DUF620

?
pfam04788: DUF620 
Protein of unknown function (DUF620)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398452
Aligned: 37 rows
Threshold Bit Score: 403.54
Threshold Setting Gi: 300154283
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AQK84813     130 MYAVGKVLMRTRSSstttkqgqKARRTGMVGVv-hGGAEIAGGLVLWQKGPEVWCVEMVVAGg-TKMSAGSDGRVAWRQT 207 Zea mays
1_pfamImport   1 MYASGRVRMEMAQE-----------HGVSSSGs-aSKGHHKGCFVVWQMVPDMWLVEFAVSG--HQIAAGSDGKVAWRRT 66 
ERN04458     115 MYVMGKVKMVMVQVecg--ansSYTLSSSLSGs-gGGVVEEGCFVIWQMAPEKWLMELDVGT--HKVVAGSDGKIAWRHT 189 Amborella trich...
Q9FG09       104 tFVTGKITMTMVSD-----------INSSTAVssaSSVSHKGCFVMWQMLPEKWLIELVGGG--HKVSAGSDGEITWRYT 170 thale cress
KRH38019     105 VFTTGKVTMDVVDE--------LGSAGGSV-------NLEKGCFVMWQMVPDKWQIELVLGG--QKVVAGSNGAIAWRHT 167 soybean
CBI29967      99 VFATGKVRMAMVDE--------LGSSGSSTAVg-pTGVSQKGCFVMWQMVPDKWLIELVVGG--HKVVAGSDGNVAWRHT 167 wine grape
EFJ12683     124 sYAAGKIRMSLSEFet-----vNRVVRTKNPFr-pA---EAGCFVLWQMKPDMWYVELVLGGgsSKVHAGCDGKLVWRQN 194 Selaginella moe...
XP_002890744 162 gYVMGRIRTMASEFet-----gSKGSKSKNNSs-kS--VESGGFVLWHMNPDMWYMELVLGG--SKVLAGCDGKLVWRHT 231 Arabidopsis lyr...
Q9C6D0       198 AYAMGKLKMITSELet-----pTGTVRNRNSTk-----sETGGFVLWQMNPDMWYVELSVGG--SKVRAGCNGKLVWRHT 265 thale cress
XP_014661243 188 AYAMGKVRMVASEFet-----aTRVVKNRGSGa-aASAVEQGGFVLWQMSPDMWYVELAVGG--SKVRAGCNGRLVWRHT 259 foxtail millet
AQK84813     208 PWQQAHASRGPPRPLRRCV----QGLNPRSTANLFSTATWVGEKSVDGDDCFVLRVDADPLALRARSGDDVEVVRHAVWG 283 Zea mays
1_pfamImport  67 PWLGAHAARGGVRPLRRALqairQGLDPETIAAVFSPAQHIGEKHIGDEECFVLELVVDDSVLSSWSDSTAEIIKHRMLG 146
ERN04458     190 PWLPSHAAKGGVRPLRRIL----QGLDPFTVASTFLGADYVGEKQISDEDCFMLKLAVDREALVERSDSAAEIIKHNLVG 265 Amborella trich...
Q9FG09       171 PWLGDHAAKGAIRPLRRAL----QGLDPLTISSVFSSAQFVGEKEINGKDCFILKLSTDQIDLSKRSDSTAEMIKHVAFG 246 thale cress
KRH38019     168 PWLGVHAAKGGVRPLRRAL----QGLDPLAVSSVFCAAQYMGEKEISGMDCFVLKLSAEQKDLVERSDSKAEMIKHAIFG 243 soybean
CBI29967     168 PWIGAHAAKGGVRPLRRVL----QGLDPLAVSAVFSSAQYMGEKRIMGVDCFVLKLSADHTDLADRSDNTAEMIKHVIFG 243 wine grape
EFJ12683     195 PWMGPHAAKGPVRPLRRVL----QGLDPLTTATIFSGAVCVGEKRLGGEDCFVLKLAADPYTLGARSDGPAEIIRHVLFG 270 Selaginella moe...
XP_002890744 232 PWLGPHAAKGPVRPLRRAL----QGLDPRTTAYMFANARCIGEKKIDGEDCFILKLCADPATLKARSEGASETIRHTLFG 307 Arabidopsis lyr...
Q9C6D0       266 PWLGSHTAKGPVRPLRRAL----QGLDPRTTATMFAESKCVGERKVNGEDCFILKLCTDPETLRARSEGPAEIVRHILFG 341 thale cress
XP_014661243 260 PWLGAHAAKGPVRPLRRAL----QGLDPLSTARLFAEARCVGERKVAGEDCFILKLSADAETLRQRSEGPAEIIRHVLFG 335 foxtail millet
AQK84813     284 YFSQRTGLLSRLEDSHLLRVR--ATkgsplaQTTTYWETSMDSSIGDYRAVDG--INVAHAGRTVVSLSRFggstnddsa 359 Zea mays
1_pfamImport 147 FFSQRSGLLVRLEDSQLTRIQs-PG------AEAMYWETTMVSCMEDYRRVDG--LMIAHSGRSVANLLRF--------- 208
ERN04458     266 YMSQRSGLLVHLEDSYLTRIQp-PG------SQATYWETTIASSIGDYRAIEG--IMVAHSGHSSVTITRF--------- 327 Amborella trich...
Q9FG09       247 YFSQKSGLLICLEDSSLTRIQi-PG------TVPTYWETSMSSWMEDYRAIEGseVVIAHSGKTDVLISRF--------- 310 thale cress
KRH38019     244 YFSQRSGLLVYLGDSYLTRIQa-PG------SHPTYWETTMSTKIEDYRIVDG--VMIAHAGSSTTLITRF--------- 305 soybean
CBI29967     244 YFSQRSGLLVYLEDSYLTRIQs-PG------SRPTYWETTMATKIEDYRTVEG--VMIAHGGQSSAIITRF--------- 305 wine grape
EFJ12683     271 YFSQRTGLLVRIEDSHLTRIQa-SA------GEVVYWETSIESTLEDYRSVDG--LVIAHSGHSCVTLFRF--------- 332 Selaginella moe...
XP_002890744 308 YFSQKTGLLVHLEDSQLTRIQn-NG------GEAVYWETTINSYLEDYKPVEG--IMIAHSGRSVATLLRF--------- 369 Arabidopsis lyr...
Q9C6D0       342 YFSQRTGLLAQIEDSQLTRIQs-ND------GDAVYWETTINSSLDDYKQVEG--IMIAHSGRSVVTLFRF--------- 403 thale cress
XP_014661243 336 YFSQRTGLLAQLEDSHLTRIQphAG------GDAVYWETTISSFLEDYRAVDG--VAIAHAGRSAVTLFRF--------- 398 foxtail millet
AQK84813     360 GSESAgvLG-RRtcTCMEENWSIEEVDFNVVGLSAECFLPP 399 Zea mays
1_pfamImport 209 GLGVR--EH-RVs-TQMEERWTIDDVLFNVPGLAADCFIPP 245
ERN04458     328 GDGVK--VG-GAt-TRMEEAWAIEDLVFNVPGLSVDCFIPP 364 Amborella trichopoda
Q9FG09       311 GETLK--GG-ISv-TRMEEKWTIDDVAFDVPGLSVDCFIPP 347 thale cress
KRH38019     306 GDNLK--AG-PSi-TRLEESWTIDDVAFYVKGLSLDCFIPP 342 soybean
CBI29967     306 GDNLK--VG-PAi-TRMEETWTIDDLAFNVPGLSMDCFIPP 342 wine grape
EFJ12683     333 GEVAM--GH-TR--TRMEEDWTIEEVALNVPGLSEDCFIPP 368 Selaginella moellendorffii
XP_002890744 370 GDMSS--GHnTK--TTMQEAWVIDEIAFNVPGLSIDCFIPP 406 Arabidopsis lyrata subsp. lyrata
Q9C6D0       404 GEVAM--SH-TR--TKMEERWTIEEVAFNVPGLSLDCFIPP 439 thale cress
XP_014661243 399 GETAM--SH-TK--TRMEEAWTIQEAAFNVPGLSTDCFIPP 434 foxtail millet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap