Conserved Protein Domain Family
Baculo_DNA_bind

?
pfam04786: Baculo_DNA_bind 
ssDNA binding protein
Family of Baculovirus ssDNA binding proteins.
Statistics
?
PSSM-Id: 398451
Aligned: 21 rows
Threshold Bit Score: 207.161
Threshold Setting Gi: 123881628
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6QXP0    28 WQAKFINKLneNT-NAVRTLECSNRF--SLHNALLSFKKMApik--sleLKRDpvtgDLIipEKVKMDKIEr-KNKICYT 101 Agrotis segetum gra...
Q0N482     5 WQNNFLDML--KN-KRFEKVACSTSYn-KLQEQLSTLKPCV--------LYTP----GCA--KNFQVVSTK--YNILQIK 64  Clanis bilineata nu...
O55580    67 WVKVFVHNL--QR-RNISVVRCTDKFn-YLNECLQFVSQPNylpfqhlgREVEevpnRFFdqDELKLRRP---SNWHHHR 139 Leucania separata n...
ABL75968  66 WQEQMAINV--KR-GNFSIMNCSCFEgrFLKNEFCRLSNLNslhe-wedKLYP----EPD--KNIVVLEPA--NGKTTYT 133 Maruca vitrata nucl...
Q6VTV1    66 WQSLILFNL--QE-FNFTVINSNHGDlqFLEHKFKELKTLSsyye-wrkEDKPe--------NNISIMEPP--IGKCTYT 131 Choristoneura fumif...
Q7TLU9    59 WQRMVLVNC--QA-LDFSAINFHYSDlqYLKDKFTELQGLSsyye-wrkQEQPd--------DKLCIMEPA--VGKCTYT 124 Choristoneura fumif...
Q462E4    73 WMSDMISTIvsQRqQNSRIIDCISPYn-ILTECFGFIRDNEhien-hlhRLIKvqseSKDylEQLCVVEPNgaSKRNVYE 150 Trichoplusia ni sin...
Q9IK76    47 WFSWMVHNF--YK-ANTTVIMCRSKYn-ALKECMSFVQTHMpis--elePLVRtldaLKE--KNLGVMRPMh-AMGTTYT 117 Spodoptera litura n...
Q9PYV4    22 IQKSVIDRIhkRS----MVLQTSSNMl-ELKKQLNFMQSCMpit--cieDEITrddnGKLssKSINLQKRQglMSTTYYN 94  Xestia c-nigrum gra...
Q9DVX2    12 WEETLVSSL--NN-RDVRHLQCLVQYn-TLNKCLNFMKECLpis--vltELITyddnNKMvvDDKLVCEKKssKQKVMYN 85  Plutella xylostella...
Q6QXP0   102 IGLSRLGgvnKCYYWDHCIAKICKSaTAGKFLVVTGKFEPVLMDVVEEMMGKYfkrtkkQQTDePIILSGTAVTHVPSMG 181 Agrotis segetum gra...
Q0N482    65 QHYLCRD---QIFFFDHVNVRRHTK-DYGDFLVMKWSDVYRHMEDYSQVLSKH------FKVD-QVVVQDSVIINIPQDK 133 Clanis bilineata nu...
O55580   140 PQFRRQLyfaQVLLFDRVRMKRLKS-TFGESLSVTLTNGSIYHNVFGYMSKLYh----kCNEG---LLTPSSIVNLPIA- 210 Leucania separata n...
ABL75968 134 IGPRVQGkpcGFWFSDFGTIKRAKS-NFGQFFSIQYGDIHKHNNIFGNILQKHl----qSDf--SLKMEPNVCIHLPDKN 206 Maruca vitrata nucl...
Q6VTV1   132 IGRRVKGrpnGFAIAEFGSVKRAKS-NFGQFLSITWPAIHDLNEVFGNIMDQYy----kYEy--PLKLETSVCIHLPEK- 203 Choristoneura fumif...
Q7TLU9   125 IGLRVKGrpnGFAIAEFGSVHRSKS-TYGQFLSTTWSAIHEHNSVFGKVMDNYy----rYEy--PLKLESSVCVHLPEK- 196 Choristoneura fumif...
Q462E4   151 IGLRVKGgikPFYYFDYAMVKRTRN-QYGDSIAIRSANRHVYNEIYGNIMAMH------FNEEtSCKISNIYYYNMGRD- 222 Trichoplusia ni sin...
Q9IK76   118 IGKIVNNslkKYYFFDYANVRICKS-AYGHFMKVSWSKIGDHNLIYQWAMQNSl----hK----QVTLEFSTLCKLPKD- 187 Spodoptera litura n...
Q9PYV4    95 IGMRVEGgliNFYIADRCQVKMCES-THGDFISLEGDNYPMYINIYQSIMASTl-------LKpYLMINKTKLMTMGKD- 165 Xestia c-nigrum gra...
Q9DVX2    86 IGHRIKGgilNFYMWDRCVVRVCEG-GFGNFLSIKGDNYPVIKVHLQKLMGKKf-------NEdMILINNYKVFSVPEKE 157 Plutella xylostella...
Q6QXP0   182 EVDKWRQFLQKFFVLANRDNSANIASNEV--KENCMLHPMSENFFRYVFGSLedr----nvgNQVECTVGLVFSSVEEML 255 Agrotis segetum gra...
Q0N482   134 NVAAKTAFARQFYSIKSNRNQLLYMTGQL--VDKVHVEPHTPSTFDVMLSAH----------EEVNMIMGAVIEGIKQSK 201 Clanis bilineata nu...
O55580   211 -DTEREMFVRRFFWCPQERNPLLYAANDI--LDIVNVQPYTLDAFNQQFAFLaph----nrsNEAEMIMGGLIEGFKQSK 283 Leucania separata n...
ABL75968 207 KTSEREMLIRRFYIINRDNNGSIYATGRIk-NAPLDVQRMSTEGFDKLFEMDkid----gpsEEIKMFMMGTIDGVKYGK 281 Maruca vitrata nucl...
Q6VTV1   204 -DLEREAKARQFLWVRRDNNPELYTTGQL--NQPLEVVPMTLNEFDYLFEMGktd----gpsHEVPVLVCGCVDGVKYGK 276 Choristoneura fumif...
Q7TLU9   197 -EHEREAKARQFLWVRRDNNPELYATGQL--DRPLEVVGMTLSEFDLLFEIGktd----gpsQEVPVLVCGRIDGVKYGK 269 Choristoneura fumif...
Q462E4   223 ----YAKNVNKFFDISQKHNQLLFSTGKL--DKTVKCESFTLERFDEVLKLKlsdneppkpsDEVPMFVGSIIEGVKEAQ 296 Trichoplusia ni sin...
Q9IK76   188 ----ESAIMRRIFKLPVRLNEDIISREEYd-KQRIEVEQYTAADFEKVYNGGdnk----gemKEKIMIVGMVINGVKHSK 258 Spodoptera litura n...
Q9PYV4   166 DLAKKTAVLQKFYVASVEDNEELYATGELkeDQMVHVTPMTMEKFHTLFSLNptk----kstDAVEFVVASVIIGVNKGV 241 Xestia c-nigrum gra...
Q9DVX2   158 EVDGRRYMMQKFFVAENVNNATNASSDKC--IEPTTLSPMSDEMFDALFKIErgk----kfgQDITFVVGSIIKGVEEAK 231 Plutella xylostella...
Q6QXP0   256 AKRTVSSlSTTEEVKESAFTLRLEPAIVIYHD 287 Agrotis segetum granulovirus
Q0N482   202 SAVEMIT-LNNKKILEKTYSFSIKPVIFFHIQ 232 Clanis bilineata nucleopolyhedrovirus
O55580   284 NETKMQT-MELEGTLYKEYTVAIKPMVFFNLS 314 Leucania separata nucleopolyhedrovirus
ABL75968 282 -EMQMTD-MNNKKITEKPYSLAFKPGIFVIIE 311 Maruca vitrata nucleopolyhedrovirus
Q6VTV1   277 -EIQLTD-VNNRKFSEKPYSLAFKPILFLILE 306 Choristoneura fumiferana DEF multiple nucleopolyhedrovirus
Q7TLU9   270 -EIQMTD-VNGRKFSEKPYSLAFKPVLYLILE 299 Choristoneura fumiferana multiple nucleopolyhedrovirus
Q462E4   297 KEESLHL-LSGKKIKEKPLSLAIVPMIFFHIK 327 Trichoplusia ni single nucleopolyhedrovirus
Q9IK76   259 NDSVIHT-SGNQTVEGKRYYLAAEPMILIDIV 289 Spodoptera litura nucleopolyhedrovirus
Q9PYV4   242 SRDELYMlDGSCDSNTSVYSLNVDHKIFIYFE 273 Xestia c-nigrum granulovirus
Q9DVX2   232 RDSEITTfNCSNVLVDNVYTMNIVPEMFIFFE 263 Plutella xylostella granulovirus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap