Conserved Protein Domain Family
LMP

?
pfam04778: LMP 
LMP repeated region
This family consists of a repeated sequence element found in the LMP group of surface-located membrane proteins of Mycoplasma hominis. The the number of repeats in the protein affects the tendency of cells to spontaneously aggregate. Agglutination may be an important factor in colonisation. Non-agglutinating microorganisms might easily be distributed whereas aggregation might provide a better chance to avoid an antibody response since some of the epitopes may be buried.
Statistics
?
PSSM-Id: 398445
Aligned: 7 rows
Threshold Bit Score: 126.509
Threshold Setting Gi: 1197337
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAX37298      497 TLLPQLNDNDSEIVKAKESLNAEITNANKAVNQNDNASMQSAKSSLDDKVTKIQNQLTEFNKDKDAKFKELEQTRKDIDN 576  Mycoplasma ho...
WP_012855702  135 MLDNKLIDNDVDIQKTKKDLNSQIINALEIFNKNNIDEINNLNKSLTFKISEVEDILIKFKQSKEQEFEKLQKTRKLVEE 214  Mycoplasma ho...
WP_012855330  209 QLLPQLSDNDSEIAKAKKSLDAEIKNANQAVASNNTASMQSAKSSLDAKVAEITKKLETFNKDKEAKFNELKQTRNQIQE 288  Mycoplasma ho...
CAA57229      277 TLSAKLTDKDNTIQQAKTELEKEVQKANQAIKSNNTASMQSAKSSLDAKVAEITKKLETFNKDKEAKFNELKQTRNQIQE 356  Mycoplasma ho...
CAA64859      277 TLLAKLTDKDNTIQQAKTELEKEVQKANQAVASNNTASMQSAKSSLDAKVTEITKKLETFNKDKDAKFKELEQTRKDIDE 356  Mycoplasma ho...
WP_121120288  506 QLLNKLVDSDKDIQKAKTELSQEIQSASQELNLNNPTSMQSAKESLDAKVTEITKKLETFNKDKDVKFKELEKTRKDIDE 585  Mycoplasma ho...
CAA64858      340 EFKKLLIDNDQKIVDLKSNLDNEISKAEQSL-SKDKESMESANDLLNTKLIEYKEILNKFNQEKEAKFNELEQTRKNIEN 418  Mycoplasma ho...
CAX37298      577 FLTDDVKNNP----NYATLVKDLTNAKDDKKSVTKSSNKSEIIAANDELKQALdkaKVAKDQIDEANKSIKEQL 646  Mycoplasma hominis ...
WP_012855702  215 FLAKDVVKSD----YYANIVRNLNREVSRRGNVSISSNKSEIVAANINLNEVL---KQSKEFVENDMQKLRDSL 281  Mycoplasma hominis
WP_012855330  289 FI-NTNKNNP----NYSELISQLTSKRDSKNSVTDSSNKSDIESANTELKQALakaNADKVQADNLAKSIKEQL 357  Mycoplasma hominis
CAA57229      357 FI-NTNKNNP----NYSELISQLTSKRDSKNSVTDSSNKSDIESANTELKQALntaKAKKSSIDNELRPLKNDL 425  Mycoplasma hominis ...
CAA64859      357 FI-KQIENDPqtkkNYQNIVKNLKDKKAEKNSITFSNNKKEIQDANKSLQDELnnaKITKKGITDFYNS-KKQL 428  Mycoplasma hominis ...
WP_121120288  586 FI-NTNKTNP----NYSTLISELTSKRDSKNSVTNSSNKSDIETANTELKQALakaNTDKDQADNLAKSTKEQL 654  Mycoplasma hominis
CAA64858      419 FLTDEVKNNP----NYATLVKDLTNAKDAKKSVTNSSNKSDIIAANEALIQALadaNKAKDQVDEANKSIKEQL 488  Mycoplasma hominis ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap