Conserved Protein Domain Family
DUF616

?
pfam04765: DUF616 
Protein of unknown function (DUF616)
Family of uncharacterized proteins.
Statistics
?
PSSM-Id: 398436
Aligned: 32 rows
Threshold Bit Score: 422.068
Threshold Setting Gi: 75120687
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDY09347     187 TETCDKPRFGGHQTLKERERSYSAI--NQTIHCGFVKGtnglHQRAGFDLSEKDRAYMKNCV-VSVSSCIFGSSDFLRRP 263 rape
XP_004981625 149 tessRFNSFTGYQTLTERDESFKTKe-SVTVHCGFY------DENGGFRVSAADKEYMRYCK-VVVATCAFGGGDDLHQP 220 foxtail millet
CBI19623     168 tepsRFNMFTGYQTLDQREESFKANe-TALVHCGFY------SENGGFKISDEDRTYMQTCK-VVVSTCAFGGGDDLYQP 239 wine grape
EFJ18225      96 GDQSKRPLFGGYQTWKERDESFKIKp-AMQVHCGF-------MNNSGGDIHPRDKTYLKRCE-FVVASGIFDGYDMPHQP 166 Selaginella moe...
XP_002280425 148 NEFQSPPLFGGHQSWLQREKSFRLKs-TMKVHCGF-------MQNGGAEMNPIDINYAKKCR-FVVASGIFDGYDTPHEP 218 wine grape
XP_002866803 148 SQF---PLFGGNISWSERDESFKLKp-EMKVHCGF-------MPRGGAEMSSLDKEYVKKCR-FVVATGIFDAYDEPHQP 215 Arabidopsis lyr...
ERN19132      44 eSFNGDPLFGGRQTWEERDESFKLNt-TMRVHCGF-------MKHGGAEMEAMDVKYVKKCK-FVVASGIFDGYDTPHQP 114 Amborella trich...
XP_015643103 121 DPS---PLFGGRQSWKQREDSFKLNa-TMKVHCGF-------MKNSGADMDDVDVKYIQKCK-FVVASGIFDGYDIPHQP 188 Japanese rice
XP_004244805 111 yiqgNADSFGGNFSIRKRFSYFDHHd-GIQVPCGFFKR---------FPISKFDRISMENCKgIVVISAIFNDHDKIRQP 180 tomato
CBI30873     114 yiqgNADTFGGNFSTQKRISYFDHRddGKEVPCGFMKE---------FSISKSDRIAMEKCGsVVVVSAIFADHDKIRQP 184 wine grape
CDY09347     264 ATkkISEFSKQNVCFVMFLDEQTLSKLASEGHvPDKQ---GFVGLWKTVVV-SNLPYTDMRKTGKVPKFLSHRLFPSSRY 339 rape
XP_004981625 221 IG--MTENSFRKVCYVAFWDEVTRAAQEEEGNmIGED---NKIGLWRIILV-SDLPFSDQRLNGKIPKLISHRLFPMARY 294 foxtail millet
CBI19623     240 IG--MSETSLQKVCYVAFWDEITRMTQELQGNrIGEN---HFIGIWRIVVV-RDLPFTDQRLNGKIPKMLGHRLFPQARY 313 wine grape
EFJ18225     167 SN--LSDASRSLFCFAMVVDEISLDSIKAEGLlTEDDkggRWSGIWRLVLL-KNLPYDEPRRNGKVPKLLTHRIFPAAKY 243 Selaginella moe...
XP_002280425 219 SD--ISARSKKLFCFLMVMDEISLDFIKKNVTvKEDVdggLWVGIWRLVLL-KHPPYDEPRRNGKVPKILTHRLFPEAQY 295 wine grape
XP_002866803 216 SN--ISKRSKNLFCFLMVVDEVSLDFLRKNTTvRKDVeggKWVGIWRLILL-KTPPYDEPRRNGKVPKILTHRLFPEAQY 292 Arabidopsis lyr...
ERN19132     115 SN--ISTRSKKLFCFLMVVDEISFTNITKTDAvTEDSdggKWVGIWRLIVL-HEPPYDEPRRNGKVPKILTHRLFPQAQY 191 Amborella trich...
XP_015643103 189 SN--ISIRSQKLFCFLMVVDEVSLDFIEKNTTvKFDKaggKWVGIWRLITL-HRLPFDEPRRNGKVPKILTHRLFPQAWY 265 Japanese rice
XP_004244805 181 KG--LGKDTPYSVCFYMFFDDVTLKGLQYHNLiSTISseeNLVGVWRIVKVeKEHLYENSAMNGVIPKYLVHRLFPNSKY 258 tomato
CBI30873     185 KG--LGSRTLENVCFFMFVDDTTLKGLDYHKViSTQSq-eYKVGAWRLVRVsSQHLYKNPAMNGVIPKYLVHRLFPNSKY 261 wine grape
CDY09347     340 SIWIDSKMRLTTDPLLIIDFFLWRTKSEFAISNHYDRHCVWDEVVQNKRLNKY-NHTAIDEQFMFYRSDGL---KKFDPS 415 rape
XP_004981625 295 SIWVDSKSQFRRDPLGVLEALLWRSNSSLALSEHGARSSLYDEAKAIVKKHKA-TPEEVKVQLDQYRQDGIpdeKRFNGK 373 foxtail millet
CBI19623     314 SIWVDSKSQFRRDPLGVLEALLWRPNSVLAISEHGARSSVYDEAKAVVKKHKA-TPEEVEVQLMQYRHDGLpedKRFNGK 392 wine grape
EFJ18225     244 SIWIDGKMELVVDPILILERYLWRGGHKFAIARHKHHKSIYEEADANKRRKRY-ARPLIDKHMEIYKREGM---QPWSKA 319 Selaginella moe...
XP_002280425 296 SIWIDGKMELMVDPLLILERYLWRGKHTFAIAQHKHHHSIYEEADAIKRRKRY-ARPLIDLHMKIYSYEGM---KPWSPK 371 wine grape
XP_002866803 293 SIWIDGKMELIVDPLLILERYLWRGKHTFAIAQHKHHRNIYEEADACKRRKRY-ARPLVDLHMKIYRYEGL---EPWSIK 368 Arabidopsis lyr...
ERN19132     192 SIWIDGKMELIVDPLLILERYLWRGRNTFAISQHKHHRSIYEEADANKRRKRY-ARPLIDLHMKIYVYEGM---EAWSPK 267 Amborella trich...
XP_015643103 266 SIWIDGKMELIVDPLLILERYLWRGKYTFAVAVHKHHKSIYEEGDAIKRRKRY-ARPLVDLQMKMYYHEGM---EPWNPK 341 Japanese rice
XP_004244805 259 SIWIDAKIQLVVDPFLLIHSLVVMEDVDMAISRHPFYVHTIEEAMATARWKKWwDVDGLMKQMETYCDNGL---QPWSPE 335 tomato
CBI30873     262 SIWVDAKLQLVVDPLLLIHSLVISENVDMAISKHPFFVHTLEEAMATARWKKWgDIESLKLQMETYCGLGL---KPWTQD 338 wine grape
CDY09347     416 DpnspLP--SYVPEGSFIVRAHTPMSNLFSCLWFNEVDRFTSRDQLSFAYTYLKLQrlnpdRPLRLNMFKDCERRALTKL 493 rape
XP_004981625 374 K---------ALAEASVIVRDHGPSTNLFMCLWFNEVVRFTSRDQLSFPYVLRRLR------PPGVHLFPVCARKDLVNS 438 foxtail millet
CBI19623     393 K---------ALSEASVIVREHTPLSNLFMCLWFNEVVRFTSRDQLSFPYTLWRLK-----VLKNINIFPVCTRKDLVNS 458 wine grape
EFJ18225     320 K----LPvlSDVPEGAVIIREHTPLTNLFCCLWFNEVNRFTPRDQLSFGYVVHRLN-----GSFPLFMFPNCEYNALFVL 390 Selaginella moe...
XP_002280425 372 K-----GtiSDVPEGAVIIREHTALNNLFSCLWFNEVNLFTPRDQLSFGYVVYRLG-----GLFKFFMFPNCEYNSLFVL 441 wine grape
XP_002866803 369 K-----NtvSDVPEGAVIIREHTAMNNLFSCLWFNEVHLLTPRDQLSFGYVVDRLK-----GAFKVFMFQNCEYNSLFEL 438 Arabidopsis lyr...
ERN19132     268 K-----RtpSDVPEGAIIIREHTPMTNLFSCLWFNEVNLFTPRDQLSFGYVVYRLK-----GAFKFFMFLNCEYNSLFIL 337 Amborella trich...
XP_015643103 342 K-----RmpSDVPEGAVLIREHTTMSDLFSCLWFNEVNLFTPRDQLSFGYVVYRLG-----DALKFFMFPNCEYNSLFIL 411 Japanese rice
XP_004244805 336 K-----PypSDVPDSAIILRKHSVATNLFSCLLFNELEGFNPRDQLAFAYVRDLMD-----PKLKLNMFDVEVFEQVAAE 405 tomato
CBI30873     339 K----LPytSDVPDSALILRKHGMRSNLFSCLLFNELEAFNPRDQLAFAYVRDKMR-----PKVTMNMFEVEVFEHIAVE 409 wine grape
CDY09347     494 FHH 496 rape
XP_004981625 439 FGH 441 foxtail millet
CBI19623     459 MGH 461 wine grape
EFJ18225     391 HKH 393 Selaginella moellendorffii
XP_002280425 442 HPH 444 wine grape
XP_002866803 439 HPH 441 Arabidopsis lyrata subsp. lyrata
ERN19132     338 HRH 340 Amborella trichopoda
XP_015643103 412 HRH 414 Japanese rice
XP_004244805 406 YRH 408 tomato
CBI30873     410 YRH 412 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap