5ME0


Conserved Protein Domain Family
IF2_N

?
pfam04760: IF2_N 
Translation initiation factor IF-2, N-terminal region
This conserved feature at the N-terminus of bacterial translation initiation factor IF2 has recently had its structure solved. It shows structural similarity to the tRNA anticodon Stem Contact Fold domains of the methionyl-tRNA and glutaminyl-tRNA synthetases, and a similar fold is also found in the B5 domain of the phenylalanine-tRNA synthetase.
Statistics
?
PSSM-Id: 398434
Aligned: 98 rows
Threshold Bit Score: 33.9756
Threshold Setting Gi: 81829398
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ME0_W          1 MTDVTIKTLAAERQTSVERLVQQFAD-AGIR-KSADDSVSAQEKQTLIDHLNQK 52  
XP_001523728  223 PPFISVSNLATTLHVSLQDVFKKLEG-LGFEdIRHSFILDKENATLIADEYGIE 275  Lodderomyces elongisporus NRRL YB-4239
P25038         63 pNYISVNKLANLLNCRVERLIKDLTA-LGFEnITTTYILSKEYVELILQEYNFa 115  Saccharomyces cerevisiae S288C
O59683         93 PAVLSVASFANLLQIPTRRILRDLNR-LGIKdVFPEYLITYEYSSLLAEEYGFD 145  Schizosaccharomyces pombe 972h-
Q2GQL9        349 PEFISVSNLAIALGQKIDVFVSQLEE-LGFEeVSKDNILTGETAALVAQEYGFE 401  Chaetomium globosum CBS 148.51
Q2KXY7          1 MSSNTVAQFATELKMPANVLLEQLRA-AGVDlKSVDDSVTDSDKAKLLDSLRRA 53   Bordetella avium 197N
Q7NY13          1 MVLTNVKQFASEMNLTPERLLEQLRA-AGVSkRSPEDSLSAQDKSQLLDYLKRS 53   Chromobacterium violaceum ATCC 12472
Q12AU7          2 SSTTTVAEFAAELNKPTATLIEQLTS-AGVAkVQASDHLSEVDKQKLLGYLQAS 54   Polaromonas sp. JS666
Q9JYD2          1 MSNTTVEQFAAELKRPVEDLLKQL-KeAGVSkNSGSDSLTLDDKQLLNAYLTkk 53   Neisseria meningitidis MC58
Q5NIL7          1 MAEITVGQLAQQTNKEVDALLKQL-KsFGIEkSSEKDTLTPTEMKTLLEKINsa 53   Francisella tularensis subsp. tularensi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap