Conserved Protein Domain Family
DUF575

?
pfam04746: DUF575 
Protein of unknown function (DUF575)
Family of uncharacterized proteins. Contains several chlamydial members.
Statistics
?
PSSM-Id: 113513
View PSSM: pfam04746
Aligned: 6 rows
Threshold Bit Score: 165.302
Threshold Setting Gi: 75532575
Created: 20-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9K2A2        19 AFNFSRPLYSRITHFALGVIKAIPIVGHLVMGVDWLISHCFERGVSHPGFPSDIAPILKVEKIAGRDHISRIENQLKSLR 98  Chlamydia pneum...
CRI35831      20 AFDFTHPVCSRITNFALGIIKAIPVLGHIVMGIEWLISWIPRHTVRHGMFTSDVSSAIKVEQTRGHNCLAPLEAYLSSLR 99  Chlamydia pneum...
Q9Z887        19 AFDFTRPLGSRITNFALGVIKAIPILGCVVIGVSWLVSTCSARRFGKPAFTSDVASIVKIEKTRGYNPLAWVEQYLRQLR 98  Chlamydia pneum...
Q9JS27        19 AFDFTRSLCSRISNFALGVIALLPIIGQLYVGLDWLLSR-----IKKPEFPSDVDQIVRVEHVVGHDHRSRVEDILKRQR 93  Chlamydia pneum...
WP_011126147  19 AFDFSLPFCARITEFVLGVIKGIPVVGHIIVGIEWLVSRYLESFVTKPTFVSDVVSLLKTEKVAGRDHIARVVETLKRQR 98  Chlamydia pneum...
WP_010892018  31 AFDFSRPFCSRVTNFALGVIKAIPIVGHIVMGMEWLVSSCVAGIITRSSFTSDVVQIVKTEKALGRDHISRVAEILQRER 110 Chlamydia pneum...
Q9K2A2        99 KTIEVEDLDKVHGQYQENPYA 119 Chlamydia pneumoniae
CRI35831     100 VPISQEDLGKVHGRTPEDPFV 120 Chlamydia pneumoniae
Q9Z887        99 VRLPEGDLGKIHGKVSRDYVC 119 Chlamydia pneumoniae
Q9JS27        94 LSLEPRDEGKVRGDLPSAPFF 114 Chlamydia pneumoniae
WP_011126147  99 VAVAPEDEDKVHGKIPVHPFG 119 Chlamydia pneumoniae
WP_010892018 111 GTITPENQDKVHGKFPVCPFG 131 Chlamydia pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap