2ZXC


Conserved Protein Domain Family
Ceramidase_alk

?
pfam04734: Ceramidase_alk 
Click on image for an interactive view with Cn3D
Neutral/alkaline non-lysosomal ceramidase, N-terminal
This family represents N-terminal domain of a group of neutral/alkaline ceramidases found in both bacteria and eukaryotes. The EC classification is EC:3.5.1.23. The enzyme hydrolyzes ceramide to generate sphingosine and fatty acid. The enzyme plays a regulatory role in a variety of physiological events in eukaryotes and also functions as an exotoxin in particular bacteria. This N-terminal domain carries two metal-binding sites, the first for Zn2+ residing within the domain, and the second, for Mg2+/Ca2+ lying at the interface between the two domains.
Statistics
?
PSSM-Id: 398420
Aligned: 120 rows
Threshold Bit Score: 550.943
Threshold Setting Gi: 283133532
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZXC_A                 5 YRFGLGKADITGEAAE-VGMMGYSSLEQKTAGIHMRQWARAFVIEEAaSGR--RLVYVNTDLGMIFQAVHLKVLARL--K 79  Pseudom...
WP_051494815          60 FLVGCGIGDTTGAVVGpSGTTGYADPNLPATGLLMRTWARAFVIADRaSGS--RLVYVTVDICLVLQSVYLAVIQEL--A 135 Nocardi...
goetting:NONO_c29360  41 YLVGAGIADVTGAVAG-QGMMGYSELDQVASGLLMRTWARAYIVVDRaTGD--RIAFVSADIACLFQSVHLAVIQRL--A 115 Nocardi...
WP_025349911          43 YLVGCGIADVTGAVAG-QGMMGYSDLEQVAEGLLMRCWARAYIVVDQaTGD--RIAFVTVDIACLFQSVHLAVMRRL--A 117 Nocardi...
Q4JV90                60 FQVGRGLADMTGEPWG-AGMFGYAVDEQKTVGIQRRQYARAFIFVDAnRDNs-RLVHVTCDVGLMFQSIHLEVLRRL--K 135 Coryneb...
BAI64297              90 YLVGAGAADITGEPGE-VGFMGYGETSQKGSGVHTRQYARAFIAVD--RASgkRNLIVVLDTLTSWQSLRDELVKRIraE 166 Rothia ...
CeBiTec:AFR_19975     42 YQVGVGIGDITGEAAE-VGMLGYADPTQTTAGLASRLWARAFVVAD---GSgnHVAFVSTEIDFVTQAVQVEVLKRL--R 115 Actinop...
WP_012389433          74 YLVGVGISDITGPAAE-VGMMGFAETAQKTEGIYMRLWSRAYIIGD--ASK--RVVFVSADLGMIFQSIKQAVSKKI--- 145 Leptosp...
Q095I8                50 FQVGSGIYDITGPAAE-LGMMGYAMIDQKTAGIHQRLRARAFVVASPcNGK--RVAFVSADAGQIFQGVRQQVVERL--K 124 Stigmat...
Q1DEP2                50 FLLGAGSADITGPAAE-VGMMGYGMLEQQTTGIHQRLHSRAFVIASPcNGK--RVAFVSADLGMVFQAVKQQVVERL--R 124 Myxococ...
2ZXC_A                80 AK---YpGVYDENNVMLAATHTHSGPGGFSHYAMYNLSVLGFQEKTFNAIVDGIVRSIERAQARLQPGRLFYGSGELRNA 156 Pseudom...
WP_051494815         136 AK---FgDLYTERNVNINSTHNHSSCGGTAREYAYSLPNFGFMETSHHAEVNGIVAAIVAAHERLAPGSVLLGRGTLTDA 212 Nocardi...
goetting:NONO_c29360 116 QR---FgALYTERNVNVNATHNHNSCGGTAREYAYSLAAYGFQNNSHQAEVDGIVAALVAAHDNLAPGTLALGHGELHDA 192 Nocardi...
WP_025349911         118 QR---FgDLYTERNVNLNATHNHNSCGGTAREYAYSLAAYGFQQNSHYAEVNGIVEAIARAHERLAPGTLGLGRGELHDA 194 Nocardi...
Q4JV90               136 EK---FgDLYNQSNVLLAATHTHVAPGGTSQHLMVDITHGGFRPKTFEATVAGIVTAIERAHADIQPSEVTVAETTVADA 212 Coryneb...
BAI64297             167 -----FgSAYDESNIMITATHTHATPGGITHQSLYNITTLGFHQDTFNAQVDGSLKAIRQATKDLSPGNLTISSSKLTGV 241 Rothia ...
CeBiTec:AFR_19975    116 AK---HgSTYTDQNVVLTATHTHSAPGGYSEYMLWNLTTLGFEAPVFEAIVAGIVRAVDSADADLAPGSVKIAEGNLAGA 192 Actinop...
WP_012389433         146 ATdseLaPFYSEANVLLSATHTHSGPGGYSHYFLYNATTSGFIKENFDVIVNGIYKSIKLAHQNLVPGNVYVNQGELTDA 225 Leptosp...
Q095I8               125 AR---FgNLYTDENVVLSATHTHSGPGGFSHYALYNLTILGYDRQNFEAIVDGIFQAIVQAHINLVPGNVRITSGDLLGA 201 Stigmat...
Q1DEP2               125 AR---YgDLYTDDNVLLSATHTHSGPGGYSHYTLYNLTTLGFSPQNFEAIVSGIVASIVRAHERLAEGTLRLSSGELFGA 201 Myxococ...
2ZXC_A               157 SRNRSLLSHLKNP--DIAGYEDGIDPQMSVLSFVDAngeLAGAISWFPVHSTSMTNANHLISPDNKGYASYHWEHDVSRK 234 Pseudom...
WP_051494815         213 SANRARVAFELNPdeDKAVFPEAIDPSVTVLRLRQgg-rDVGAITWFATHGTSLTDHTSLIAGDNKGYASYRWEHEEKGV 291 Nocardi...
goetting:NONO_c29360 193 SANRSRVAFELNPpeDKSEFPNAIDPKVTVLRLRQga-kDIGAITWFATHGTSLTDANTLISADNKGYASYRWEHDEMGV 271 Nocardi...
WP_025349911         195 SANRSREAFELNPaqDKAEFPNGIDPAVTVLRIRQgs-kDIGAITWFATHGTSLTDANRLISADNKGYAGYRWEHDEMGV 273 Nocardi...
Q4JV90               213 GVNRSKTSWDRNPeeDKKALPNGVDTRSVTLHVSRgg-kQVGLINWYSLHPTSFGAEYKHIAGDNKGYAAWATEEAHGVV 291 Coryneb...
BAI64297             242 GVNRSREAFNLDSpeIRSKLPGGTDPTNMTLRLERng-kTRAVLNWFAIHPTSLTSKNTLISSDNKGYAEYLLENQDHGV 320 Rothia ...
CeBiTec:AFR_19975    193 NVNRSIEPFNANPaaDKARFPDAVDTRMTVLRFEQgg-rPVGLIDFFATHGTSMTPANHLISADNKGYAAHVIEDEVHGV 271 Actinop...
WP_012389433         226 SKNRSVAAYDKNPasERNFYPSNVDQTMTLLKLVAAdgrELGMVNWFAVHPTNVGPTNKLIGGDNKGIASYLFEKNKGTN 305 Leptosp...
Q095I8               202 TINRSPGAYLRNPaaERGQSPYDTDKRMTLLKLQGAdgaEVGLINWFAVHGTSMGNDNRLISGDNKGYASYLFEKDKGTN 281 Stigmat...
Q1DEP2               202 SRNRSPNAYLLNPaeERARYAHDVDTRMTLLRLTRAdgtDMGLINWFAVHATSMGNGNTLISGDNKGLASYLAEQAQGAG 281 Myxococ...
2ZXC_A               235 --------SGFVAAFAQTNagnlsp--nlnlkpGSGPFD---NEFDNTREIGLRQFAKAYEIAGQAQEE--VLGELDSRF 299 Pseudom...
WP_051494815         292 ryg--egqPEFIAAFPQTNsgdmtpnlalipwqPTGPTE---DNRLNCAIIGERQYQAARAAFDAARPM--SSGSIDSVV 364 Nocardi...
goetting:NONO_c29360 272 rhr--eggAGFVAAFAQTNagdmtpnlgltpwhPSGPTE---DNRLNCALIGERQYQAGRAAFDAARPM--SGGGVDAAL 344 Nocardi...
WP_025349911         274 ryq--dgqPGFLAAFAQTNagdvtpnlglgkfhPNGPTD---DHRANCALIGERQYRSGRAVFDSATPM--RSTGVDAVL 346 Nocardi...
Q4JV90               292 hry--pedAPFVAAFANMTpgditp--nmgltpNSGPGA---DERESAQILGERMMAATNDL-----GKdwSAGGIDGRM 359 Coryneb...
BAI64297             321 drnvpgsgDGFVAAFANANagdvsp--ntwlkpGQGPTN---DQFKNVKIQGEKQANAVRSQLKSAGTP--VGKGLDSRI 393 Rothia ...
CeBiTec:AFR_19975    272 dwa---hrGDFVAAFAQTSagdmsp--nlrnggAQGPTD---DEFENTRIIGQLQAGKAQQLFDSATEE--LSGPIAARG 341 Actinop...
WP_012389433         306 ys----snQTFVAAFAQSNsgdv-------tpnlWGPADgvnD-YARQNTIANKQYQKAVSLYQSANTQ--VTGTIDFRH 371 Leptosp...
Q095I8               282 yl----asKTFVAAFAQSNegdvtpn-ilggtnGGGAN-----DFESTELSGRKQYVLAKQLYDGASQP--LVGAVDYRH 349 Stigmat...
Q1DEP2               282 --------DTFVAAFANANegdvtpn-ilggthGGGAN-----DFEDTDLSGRKQYDFAAKLWAEAKTP--LTGGVDYRH 345 Myxococ...
2ZXC_A               300 RFVDFTRLPIRPEf-tDGQPRQLCTAAIGTSLAAGSTeDGPGPLG---LEEGN------------NPFL-SALGGlLTGv 362 Pseudom...
WP_051494815         365 HYIDMGNVAVDAAytpDGRMARTSPGMLGTSFFAGKStDNWNRVVp-fVSEGMt-----------NPLV-AALGG-LNGp 430 Nocardi...
goetting:NONO_c29360 345 RYLNMADIAIDGSytpDGKPARTAPAMMGAAAAATSSeDNWKTQLs-fLQEGDt-----------NPVV-AALGG-LNGp 410 Nocardi...
WP_025349911         347 RYIDLSAITIDGAytpDGGPARTTAAMMGASAMAASSeDNTRSQLa-fLYEGQr-----------NPVV-EALGG-VDAp 412 Nocardi...
Q4JV90               360 RWVNCPQLVASPRftpDKKEHKLGPAVLGAAFAGSSQeDGGGVPIl-gFNEGErg---------gNP-WvRDLNNfL--- 425 Coryneb...
BAI64297             394 SYFNFSGMNVDAKytgSGHNERTCQGFLGTPFGAGSTeDGGGGWAv--YKEGSg-----------RP---SILGTlVFT- 456 Rothia ...
CeBiTec:AFR_19975    342 RYVDFSGVQVGGAytpDGQAHTTCPGALGQNFTAGAE-DGPGPPI---VDEGDln---------tNPLL--LVAGiVVNp 406 Actinop...
WP_012389433         372 TYVNFSNLYVSSV------GTSTCPAGMGASFSAGSVeDN--AVSvdfFDEGTtvdsldwnsnaaDAFKaSFLGGaLGVl 443 Leptosp...
Q095I8               350 AYVKMDEVSVAPKy-tDGVWRSTCEAAIGVSMLAGAE-DGPGFGS-----EGAtce------qvrN-IWsEFTCGlTTTs 415 Stigmat...
Q1DEP2               346 VYVKMDAVDVAPAf-aDGAPRTTCPAAIGVSMLAGAE-DGPGVGV-----EGVtca------agqN-AWgQFSCSlATTp 411 Myxococ...
2ZXC_A               363 PPQELVQ----CQAEKTILADTG---NKkPYPWTPT----VLPIQMFRIGQLELLGAPAEFTVMAGVRIRRAVQAASEAA 431 Pseudom...
WP_051494815         431 IEQWMRD----AQAPKLALAPVGf-aLP--RPWVPD----VVAIQLVRIGDLVLAAGPAEYTIVAGLRVRRLVARALGME 499 Nocardi...
goetting:NONO_c29360 411 VEQWMRD----VQAPKLIVAPLGv-lPP--RPWVPL----TVPIQILRIGDLVLASGPAEYTVVSGLRIRRVVAHALSVP 479 Nocardi...
WP_025349911         413 IEQWMRD----AQAPKLIGAPLGi-lGP--RPWNPQ----ILAIQIMRIGDLVLASGPAEYTVVSGLRIRRVVARALNIP 481 Nocardi...
Q4JV90               426 APQEIKD----IHGPKECLLPMG---------YIDGmiqqVHPFTIHRLGSFVLVSLGFEPTITSGLRMKRTVAAALGVP 492 Coryneb...
BAI64297             457 PSAAQTR----CQQPKGILFSAKng------tIIQE----KYPVQIMRFGDYYLLGMPGEFTGAVGVQYRQDAAKLFGVP 522 Rothia ...
CeBiTec:AFR_19975    407 TPAAVRA----CQAPKDVFLGTGsqnPP----WTPQ----VMPLQVLRIGQLAITTAPGEFTIVAGQRVQDAVAAQLGGV 474 Actinop...
WP_012389433         444 WPASVSEsyklCHAEKPVLIPTGv-aSFdGNPWTPP----IIPIQIVKIGNLSILAIPAEVSTMAGRRIRSLVKNIME-- 516 Leptosp...
Q095I8               416 -----------CQGEKPVVLEMG---TMvPYPWTPE----VLPLQVVTLGNLALVAVPFEMTTMAGRRLRQTVLAQLAPV 477 Stigmat...
Q1DEP2               412 -----------CQAEKPIVLEMG---SMrPFPWTPE----VLPLQLVTIGNLALVAVPFELTTMAGRRLRDTVETALAPA 473 Myxococ...
2ZXC_A               432 GIRHVVFNGYANAYASYVTTREEYAAQEYEGGSTLYGPWTQAAYQQ 477 Pseudomonas aeruginosa
WP_051494815         500 -LESVLMQGYSNGYVGYCVTPEEYAKQLYEGGHTLFGRWTAPAYMQ 544 Nocardia nova
goetting:NONO_c29360 480 -LENVLLQGYSNGYSGYVTTPEEYASQQYEGGETLYGRWTLPAYVQ 524 Nocardia nova SH22a
WP_025349911         482 -VENVLMQGYANGYSGYVTTPEEYLSQQYEGGETLYGRWTLSAYMQ 526 Nocardia nova
Q4JV90               493 -ENTVVVQGYTNAYGHYITTPEEYEAQNYEGGATIFGQYQLSAFQD 537 Corynebacterium jeikeium K411
BAI64297             523 -ESHIILQGYTNAYDHYVTTPEEYDSQQYEGGATLFGRYTSSAFRQ 567 Rothia mucilaginosa DY-18
CeBiTec:AFR_19975    475 -TTHQILAGYANAYAGYVTTPEEYDLQHYEGAATHFGRYTQSAYAQ 519 Actinoplanes friuliensis DSM 7358
WP_012389433         517 -NDYTVIAALSNSYTSYLTTREEYSSQQYEGASTQFGPNTLKAYEQ 561 Leptospira biflexa
Q095I8               478 GVDQVVIAGLSNAYAGYLVTREEYAKQDYEGASTHFGPWTLAAVQQ 523 Stigmatella aurantiaca DW4/3-1
Q1DEP2               474 GVTDVVIAGLSNAYSGYVATREEYARQDYEGASTHFGPWTLAALQQ 519 Myxococcus xanthus DK 1622
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap