3MKR


Conserved Protein Domain Family
Coatomer_E

?
pfam04733: Coatomer_E 
Click on image for an interactive view with Cn3D
Coatomer epsilon subunit
This family represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex.
Statistics
?
PSSM-Id: 398419
Aligned: 7 rows
Threshold Bit Score: 350.626
Threshold Setting Gi: 6647484
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MKR_A   1 DELFDVKNAFYIGSYQQCINeaqrVKPSSPERDVERDVFLYRAYLAQRKYGVVLDEIKPSS-APELQAVRMFAEYLASHS 79  cattle
Q9Y0Y5  12 SVLFDARNEYYIGNFMGSINf---VLPEQGTAGPELLSYMYLSYLAIDSGRIVASDIKEGN-STPLQALRLVHEAFEQPS 87  fruit fly
Q9MAX8   5 DHLFNLRNNFYLGAYQAAINss-dVANLSQEDTLERDTLVHRCYIALGQLQFVISEIHDDA-PTPLQAVKLLALYFSSPD 82  soybean
Q9M639   5 DLLFNLRNLFYLGAYQAAINns-dVPGLDADAAAERDAIVFRSYIALGSYQLVISEIDSSA-ATSLQAVKLLALYLTG-- 80  Zea mays
O64748   9 DHLFNLRNNFYLGAYQTAINns-eIANLSPENAVERDCLVFRSYIALGSYQLVISEIDESA-ATPLQAVKLLAMYLSTPQ 86  thale cress
O74767  10 NELYFVRQYFYSGNYTKLFei--dTTSMSEKGLELTEIYMARAKLALGESLESIQSI-LTQkTPGSAAILALAGEGNM-- 84  Schizosaccharomyces p...
O62246   3 DKLFSIRNYFFLGSYQSCIGealkFSSKNEEEKQEKDVYLYRSYIAQGQAFIPLKEIPAATkSADLAAVRRYAEFRNNPA 82  Caenorhabditis elegans
3MKR_A  80 RRDAIVAELDREMSRSVDVTNtTFLLMAASIYFYDQNPDAALRTLHQG-DSLECMAMTVQILLKLDRLDLARKELKKMQD 158 cattle
Q9Y0Y5  88 RTEELLEKLTDKVAGEEDETN-IWHLATAIVYCHDGQFENALKILHGS-TNLESMALSVQCLLRLQRVDLAKQLVAKMQE 165 fruit fly
Q9MAX8  83 TKDSAIASLKEWLADPAIGNNaTLRLVAGLVFLHENDFNEALKHTNAG-GTMELHALNIQIFIKMHRSDYAERQLRIMQQ 161 soybean
Q9M639  81 DKEGAISSLKEWLSDSAIGSNpVLRLIAGIVFMHEQDYNEALKHTHSG-GTLDLHALNVQIFIKMHRSDYAEKQLKIMQQ 159 Zea mays
O64748  87 NKESTISSLKEWLADSTIGNNdTLRLIAGIIFMHEEDYNETLKHTHAG-GTMDLYALNVQIFIKMHRAEYAEKQLRVMQQ 165 thale cress
O74767  85 ----------ELIIDQHGNSDsVVQTLGAIFQIKNGSFDDAMDLLKKSvENLEAVALQVYIHLREHKIEAAEQTLKQALD 154 Schizosaccharomyces p...
O62246  83 AKKKILAEVQEEVASRNI-KSeIAAVLAATILNEADLSQDAFRAVSRF-EGLEARASKVFILIKMNKRKLAIGEVKKMNQ 160 Caenorhabditis elegans
3MKR_A 159 QDEDATLTQLATAWVSLAAGG-EKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGVLQEALDKDSGHPETL 237 cattle
Q9Y0Y5 166 ISDDATLTQLAQAWVALAQGT-EQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTL 244 fruit fly
Q9MAX8 162 IDEDHTLTQLANAWLNLAVGG-SKIQEAYLIFQDLSERYQSTSLLLNGKAVCCMHMGNFDEAETLLVEALNKDARDPETL 240 soybean
Q9M639 160 IDEDHTLTQLANAWLGIAVGG-SKIREAYLIFQDFAEKYPMTGMVLNGKAVCCMHMGSFEEAETLLLEALNKDAKDPETL 238 Zea mays
O64748 166 IDEDHTLTQLASAWLNLAVGG-SKIQEAYLIFEDFSEKYPMTCLILNGKAVCCMQMGNFDEAETLLLEALNKDAKDPETL 244 thale cress
O74767 155 WADEEIVLQLAQSWIKIVSGGvESYNDAFYVFEELNGT-DSNPMTLTGMACADICLLRPEEALSSLKTALDSQPNYEEAL 233 Schizosaccharomyces p...
O62246 161 IDEDATLSQLANALVTSFGAS-GKVKDALYIYSEMSDKYGRTTDLEMHQAVVSILTQDYAAAEELLESALERDNKDADVL 239 Caenorhabditis elegans
3MKR_A 238 INLVVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYRAKENDFDRLVLQYA 289 cattle
Q9Y0Y5 245 INLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYD 296 fruit fly
Q9MAX8 241 ANLVVCCLHLGKP---SNKSFSQLKLSHPEHVLVKRVSSAEESFDRALQSFS 289 soybean
Q9M639 239 ANLIVCNLHLGKP---SSRYLSQLKLSHPDHVLVKNAAASEATFERALQAVA 287 Zea mays
O64748 245 ANLVVCSLHVGKS---SSRHLSQLKLSHPEHILVKRVSSAEDNFERAVQLVA 293 thale cress
O74767 234 SNMTTAITDLGPDAPSQAKNILSSFTNSSTLKLNDHLNEKAQEFDTFSTQFL 285 Schizosaccharomyces pombe 972h-
O62246 240 INSIVSAQLNEKDDDVVERFISQLKHEHPNHPWVIDFNEKEAEFDRVASDSR 291 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap