Conserved Protein Domain Family
Glyco_transf_17

?
pfam04724: Glyco_transf_17 
Glycosyltransferase family 17
This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.
Statistics
?
PSSM-Id: 398414
Aligned: 25 rows
Threshold Bit Score: 516.052
Threshold Setting Gi: 388853751
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007855798  10 RRRSITLILPLLFLASLSLFYIHnnlyQLRNLLSYSTRPIWDSAD--GPTEIIPHYYAEGL-ADAYT--CQLHGWKRREN 84  Moniliophthora ...
XP_006358295  22 RSHGKVIFIVLLILVPILLFGIY----LHFHKISYFFRPLWDKPP--PPFEHLPHYYAENV-SMDNL--CRLHGWTLRPE 92  potato
XP_002527177  12 RAPWKLFFLILLVLVPICVLGIF----VHIQKISYFFRPLWDNPP--PPFKRLPHYYAENV-SMEHL--CDLHGWSLRSE 82  castor bean
XP_002324640  12 RVTFKVVFFILLILVPICVIGIL----THAQHVSYFLRPLWDNPP--PPFKHLPHYYAENV-SMEHL--CHLHGWSLRSE 82  black cottonwood
XP_003549746  19 QKPPIFFCALLLLLLPICVVGIF----IHGQKITYFFRPLWDNPP--APFTSIPHYYAENV-SMEHL--CRLHGWSLRSK 89  soybean
XP_002978663   7 RGRKILAAALVLVLI-LCLHAGY----SNFLSLSYFLRPVWDTPP--KPFDFITHYFAHNL-SRSDL--CELHNWEVRET 76  Selaginella moe...
XP_001755575  18 KFKLLTLTIFGFFSIVATLVYVY-----DYRTVTYFLRPIWDTPP--KSFQIIPHYYADGM-NLSEL--CALHGWTHRPT 87  Physcomitrella ...
EDR09043       7 rtrSNVILLFSFLFCTVILYLIVqnqyQLRNALSYATRPLWDSDS--GPKDIIPHYHAEGLkADAHT--CQLHGWEERRN 82  Laccaria bicolo...
EKD01901       4 srQHRRFLFLFLFVVVVSVLTFWsrlaLAWRDFGYLTRPLWDHPE--RPFTVVPHYPRSTL-SSSEW--CSLHGWKPRTS 78  Trichosporon as...
CCF52719      12 nivrrRWLLLSLACFLFTVVYLFkrdrTLQNTLSYSTRPLWDKSDttTPQREIKHYTAWSI-SANDTaaCRRHGWTPYTP 90  Ustilago hordei
XP_007855798  85 PQnvKVLDAVLMSSELDLLELRLNELDGVVDQFFIIESNTTFTGLPKETYYDSHKGR-FEKFESKILYQFLPGQLQTa-- 161 Moniliophthora ...
XP_006358295  93 PR--RVFDGIIFSNELDLLEVRWRELYPYVTKFVVLEANTTFTGLPKPLYFSDHRER-FAFAEDKIVHGVFPGRIASlel 169 potato
XP_002527177  83 PR--RIFDGIIFSNELDILDIRWHELHPYVTKFVILESNTTFTGIPKPLFFASNRNR-FSFAEDKIVHGVFAGRTAIhgl 159 castor bean
XP_002324640  83 PR--RVFDAIIFSNELDVLEIRWHELYPYITKFVILESNTTFTGIPKPLFFDSNRSR-FAFAKEKIVHGVFSGRIAArgk 159 black cottonwood
XP_003549746  90 PR--RIFDAVIFSNELDMLEIRWHELSPYVSKFVILESNTTFTGIPKRLFFALNRER-FSFAKQKIVHDIYPGRIAVpgs 166 soybean
XP_002978663  77 PR--RVFDAIIFSNELDLLEIRWRELYPFVTKFVLLEANGTFTGLAKPLFFAKNSYR-FLFAASKLFYREIWTRPLLe-- 151 Selaginella moe...
XP_001755575  88 PR--RVFDAVIFSNEVDLLEIRMRELMPFVTKFLVLESNATFTGKPKPLYFADQKDSrFKFIHPQLLYSNIPSRPQIp-- 163 Physcomitrella ...
EDR09043      83 n--vRVLDAVLMSSELDLLEIRMNELDAVVDYFLIVESNATFTGLPKETYFAKNRAR-YAKFERKIIYRFLPGYPLQp-- 157 Laccaria bicolo...
EKD01901      79 TP--KVFDAVIFSVEIDLLQLRLRELYDVVDGFVILESDRTFTGLPKNTTFADNKHL-FDWASDKIHYAFHEGHELKa-- 153 Trichosporon as...
CCF52719      91 AQrpKVYDVIIFSVELEMLELRFQELYDAVDAFVIVESNTTFMGKPKQLGFD--PSR-YATYRDKIKYFTIAGRALAp-- 165 Ustilago hordei
XP_007855798 162 DHDAWKVEAETRTAMSSFLRgyTKTLPSDTtfIVIMSDLDELPSAHTIKLLRDCD-FGETIHLQLRNYLYSFEWLLGLNS 240 Moniliophthora ...
XP_006358295 170 HEDPFKLEGQQRIAMNRLLH--AAGIFEDD--LLIMSDTDEIPSHHTIKLLQWCDgMPPVMHLELRHYMYSFEFPVDYSS 245 potato
XP_002527177 160 SEDPFVLESEQRAAMNSLII--RSGISHGD--LLIMSDTDEIPSPHTLKLLQWCDgIPPVLHLELRHYMYSFEFPVDYSS 235 castor bean
XP_002324640 160 NEDPFVLEFEQRKAMSGLLR--SSGISYGD--LIIMSDADEIPSPHTLKLLQWCDeIPHAMHLELKHYMYSFEFPVDYSS 235 black cottonwood
XP_003549746 167 HEDPFVLESKQRGAMNALLR--RAGISNGD--ILLMSDTDEIPSPHTLKLLQWCDgIPPIMHLELRNYMYSFEFPVDYSS 242 soybean
XP_002978663 152 NESPFTTEVFQRQQMDRALV--AAGIEEGD--IVIMSDADEIPSWHTLELLRWCDgFPSPMHLQMRNYLYSFEFLVDEKA 227 Selaginella moe...
XP_001755575 164 NRDPFDNEKHHRIAMGNFLR--TAGIQDGD--LLITADADEIPSAHTIHLLQNCDgYPSPMHLQLRNYLYSFEFLVDSNS 239 Physcomitrella ...
EDR09043     158 GQSAWDSEAHTRNTMTTLLRshIGGFPSGTqsVVLMSDIDEIPSQHTVELLKACD-FGTSIHLQLRNFLYSFEWYLGLSS 236 Laccaria bicolo...
EKD01901     154 GEHPFDQEAQMRTSMNAALE--RAGVRQGN--LVLMSDVDELPRASTLELLKTCD-YGDVIHLQLANYVYSFEFLLGHDS 228 Trichosporon as...
CCF52719     166 GEGPFAIEGEQRYKATELLR---TQVQPPQgsLIIMSDVDEIPSLAAVQLLSSCQ-APLPLHLSFKSYIYSFEFPTAAKS 241 Ustilago hordei
XP_007855798 241 WRASVVKWNA-GGYYSHIKRSEQALADSGWHCSYCFRALSEFVTKMQGFSHSDRIg--GN-MDLLKSE---KIQEKICRG 313 Moniliophthora ...
XP_006358295 246 WRASVHIYNR-WTKYRHSRQTDVILSDAGWHCSFCFRNLQDFVFKMTGYSHADRV---RR-TNFLKYS---RIQKLICEG 317 potato
XP_002527177 236 WRASVNVYGP-WTRYRHSRQTDLIFSDAGWHCSFCFRRLKEIVFKMTAYSHADRV---RR-KDFLDYS---RIQKLICNG 307 castor bean
XP_002324640 236 WRATIQIFGP-RTGYRHSRQTDLILSDSGWHCSFCFRRLQEFVFKMTAYSHADRV---RR-NEFLNYS---RIQKIICSG 307 black cottonwood
XP_003549746 243 WRATAHVYGP-RSQYRHSRQTDVIFSDAGWHCSFCFQYISEFVFKMTAYSHADRV---KR-KYFLSHS---RIQDIICKG 314 soybean
XP_002978663 228 WRPCVHLYQPgATKYGHFRRSDFILADAGWHCSFCFRHVSEILFKIRAYSHADRL---KA-SRLGSVDaeiRIQDAVCKG 303 Selaginella moe...
XP_001755575 240 WRSSVELYRK-ETQYRHSRKTDHCLADAGWHCSFCFRYIRDFVFKMKAYSHADRI---RR-PSLLNPE---RIQKIICKG 311 Physcomitrella ...
EDR09043     237 WRASANLWNS-DSFYRHSKSGERVLADSGWHCSYCFRTIPEYVVKMRGFSHADRIg--GR-IDLLDPK---RIQNTICKG 309 Laccaria bicolo...
EKD01901     229 WRASVRRHPS--TGYSHGRVSETLLGDAGWHCSFCFKHIADFQFKMQAYSHADR----SR-AELLGEE---RIQKVICDG 298 Trichosporon as...
CCF52719     242 WRAQVHAWSPtHTWYNHGKVSDNILLDAGWHCSSCFSRISDYQFKMQSYSHSDRLfgnRHwRQLLHPK---LILDKICAG 318 Ustilago hordei
XP_007855798 314 DDIFGMLPEAYSYLDLFYQMNLQPQK-SMVGLPKYLLENAQHFKFLLPGGCQRD 366 Moniliophthora roreri MCA 2997
XP_006358295 318 ADLYDMLPEEYSFQELIKKMGSIPRSaSAVHLPTHVIENTDKFRFLLPGGCQRS 371 potato
XP_002527177 308 DDLFDMLPEEYSFQELIKKMGPIPRSaSAVHLPAYLIENADNFRFLLPGGCLRS 361 castor bean
XP_002324640 308 DDLFDMLPEEHTFQELIKKMGPIPHSaSAVHLPSYLIENADKFRFLLPGNCLRt 361 black cottonwood
XP_003549746 315 DDLCDMLPEEYSFQELIKKMGSIPRSaSAVHLPAYLIENADKFKFLLPGGCLRP 368 soybean
XP_002978663 304 RDLFGLLPEEYTFKELVAKMGNAARShAAVHLPLWLLRNAHKFKFLLPGHCLRE 357 Selaginella moellendorffii
XP_001755575 312 SDIFDMLPEEFTYKELISKLGAVAKSfSGVHMPKYLLENAETYRYLLPGNCIRD 365 Physcomitrella patens
EDR09043     310 KDIFGMLPEAYSYLDLFSQMSLDPLT-SAVGLPRYLLENAEKFRFLLPGGCVRK 362 Laccaria bicolor S238N-H82
EKD01901     299 TDIFDMLPEAYSWSELARKMAPMQRTnSAMDVPRLLKEKPEQYRYLLPGGCERE 352 Trichosporon asahii var. asahii CBS 8904
CCF52719     319 KDLFDMLPEAYTWSELLYRWSGEAHSnSTANLPRGLMNDQKQFEFLLPGGCKAr 372 Ustilago hordei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap