3OMW


Conserved Protein Domain Family
Ssu72

?
pfam04722: Ssu72 
Click on image for an interactive view with Cn3D
Ssu72-like protein
The highly conserved and essential protein Ssu72 has intrinsic phosphatase activity and plays an essential role in the transcription cycle. Ssu72 was originally identified in a yeast genetic screen as enhancer of a defect caused by a mutation in the transcription initiation factor TFIIB. It binds to TFIIB and is also involved in mRNA elongation. Ssu72 is further involved in both poly(A) dependent and independent termination. It is a subunit of the yeast cleavage and polyadenylation factor (CPF), which is part of the machinery for mRNA 3'-end formation. Ssu72 is also essential for transcription termination of snRNAs.
Statistics
?
PSSM-Id: 398413
Aligned: 104 rows
Threshold Bit Score: 201.523
Threshold Setting Gi: 402468085
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OMW_D                     2 LAVAVVCSSNMNRSMEAHNFLAKKGF-NVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKD--KEFYTQNGLL 78  fru...
XP_015618526               9 MRFAMVCSSNMNRSMEAHSLLGRAGL-DVASYGTGTHVKLPGPSLHEPNVYDFGTPYNVIYDDLRRKD--PDLYKRNGLL 85  Jap...
Q9C9T0                     3 FRYAMVCSSNQNRSMEAHALLKRQGL-DVASYGTGSHVKLPGPSLREPNVYDFGTPYKQMFDELRRKD--PELYKRNGIL 79  tha...
EEF46774                   3 LRYAMVCSSNQNRSMEAHSLLKMQGF-DVSSYGTGAHVKLPGPSLREPNVYDFGTPYKQMFDDLRRKD--PDLYKRNGIL 79  cas...
Q558Z3                    22 KRIAMVCASNQNRSLEAHHLFVKNGFkNIRSFGTSAHCKLPGPSIHQPNIFSFGTPYQEIYTSLKNQD--QELYIRNGLL 99  Dic...
EFA83602                  40 KRLAMVCASNQNRSVEAHNLFLLKGYrNIRSFGTSGNCKLPGPSQDRPNIFPFGTPYQSIHESLRQQN--QELYTQNGIL 117 Het...
WGS:AAFB:cds.EHI_027340A  13 eSIAVICRSNQNRSISAHCRLKQLGY-NVSSFGTGVYTILPGATRNF--GFQFGIPYKDIKNSLPKDEasVEYYRKNKIY 89  Ent...
Q8SRQ6                     4 MKLAVTCAMNQNRSMQTHDLLAKKGI-PVKSFGTNPVIKLPGETMDKPNVYNFGVTYQQIYDDLCMKN--EDHYRESGIL 80  Enc...
XP_002996534               1 MKIAVCCAMNQNRSMEAHKILKDAGY-KIDSYGTNQHIKIPGESLETPNIYQFGTSYKEIYKDLIYKN--ASFYEKIGIL 77  Nos...
EOB12435                   1 MKIAVVCAMNQNRSMEAHKVLLEAGF-QVDSYGTNKNIKIPGESIDKPNVYPFGVSYLEIYEDLKNNN--EIFYERIGML 77  Nos...
3OMW_D                    79 HMLDRNRRIKKCPERFQDTKE--QFDIIVTVEERVYDLVVMHMESMESVDN--RPVHVLNVDVVDNAEDALMGAFVITDM 154 fru...
XP_015618526              86 PMLKRNTSVKLAPQRWQDNAGdgLFDVIFSFEERVFDLIVDDMHNREQRML--KNALIINMDVKDNHEEAGVGAKLALDL 163 Jap...
Q9C9T0                    80 QMIKRNLSVKLAPQRWQDNAGdgVFDVVMTFEEKVFDSVLEDLNNREQSLT--KTILVMNLEVKDNHEEAAIGGRLALEL 157 tha...
EEF46774                  80 PMLKRNSSVKLAPQRWQDNAAdgSFDVVFSFEEKVFDMVIEDLHNRDHVLM--RSVLVINLEVKDNHEEAAIGARLALEL 157 cas...
Q558Z3                   100 NMLERNISVKLAPEKWQEEQQs-KFEIVYTFDQRVYDAVIEDLLQRDVSSSllQPVHIINLQVKDTHEEAVGGAQHALEI 178 Dic...
EFA83602                 118 NMLERNQRVKLAPEKWQEEQLa-RFDIVFTFDQRVFDMVVDDLTQRDITAPm-QPVHIVNLQVKDTHEEAAGGASHALQL 195 Het...
WGS:AAFB:cds.EHI_027340A  90 QMLDRNANLKSAPEKFQDCKK--EFNIIITLDYSVFMDVLEYFDSRESSTG--SLCYVFNLTVMDQLDTAEKGAIEVSEF 165 Ent...
Q8SRQ6                    81 YLLERNMGVKERPENFFQRSE--DFDLVITCEERVFTSIFEYYA---DAPSctQCFFMVNFDIRDTPSDAIAGAQEILEF 155 Enc...
XP_002996534              78 KMLERNMAIKDSAEYFFNKDT--YHDLIITSEEKCFVTIYENM----VKCNgsYKSFIVNFDIKDTILDASAGALEIKDF 151 Nos...
EOB12435                  78 KMLKRNMKIKEKALNYYQCNNv-IYDLVITAEEKCFTSIFNEINYK----------FLINFDIKDNLLDASEGAQEILKF 146 Nos...
3OMW_D                   155 INMM--AKSTD-LDNDIDELIQEFEERRKRVILHSVLFY 190 fruit fly
XP_015618526             164 CQKL--EGADEdWEEIIDDLIITFEKQHKRKLTYNMAFY 200 Japanese rice
Q9C9T0                   158 CQEI--EGNET-WEDTIDDIVAGFEKQHRRKLVYSISFY 193 thale cress
EEF46774                 158 CQEI--EAAES-WEDSIDEIITAFETKHRRKLLYSVSFY 193 castor bean
Q558Z3                   179 TSII--EKTLN-WEEKLDQILEDFYKQTSRQFLHTLMFY 214 Dictyostelium discoideum
EFA83602                 196 LNLI--DETEDnWEDSMDDILEKFYRKTGRQLLYTLMFY 232 Heterostelium album PN500
WGS:AAFB:cds.EHI_027340A 166 LKLM--ESDSD-WMNNIDHVIKSFYSKTKINVLHSMQMY 201 Entamoeba histolytica HM-1:IMSS
Q8SRQ6                   156 VEDVlaKEEER-LEYAVDSALRRYFERKGVMLLFTVVnl 193 Encephalitozoon cuniculi
XP_002996534             152 VDSC--MTITGnYEFRIMKALELYNRKYSKNNIFTVief 188 Nosema ceranae BRL01
EOB12435                 147 VKNV--AELKGgFEEKVKGALEKYTETTGKMLIFTckcv 183 Nosema bombycis CQ1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap