6MZD


Conserved Protein Domain Family
TAFII28

?
pfam04719: TAFII28 
hTAFII28-like protein conserved region
The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. The conserved region is found at the C-terminal of most member proteins. The crystal structure of hTAFII28 with hTAFII18 shows that this region is involved in the binding of these two subunits. The conserved region contains four alpha helices and three loops arranged as in histone H3.
Statistics
?
PSSM-Id: 398410
Aligned: 79 rows
Threshold Bit Score: 89.0976
Threshold Setting Gi: 406699609
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6MZD_P               109 LVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMP-PLQPKHM 187
XP_004180180         218 LINNLDNEQTNRFEVFHRTSLNKTQIKKLANTVTNQNITENIRVFLQAIGKMYIDDLIEISMEVRNKW------LIGKMI 291 Tetrapi...
XP_003957609         120 LVLNLDSEQNNRFEVFHRTSLNKSQVKKLASTVCNQTISENIRVFLQAIGKVYVGEIIELALDVRKKW------FNARMA 193 Kazachs...
XP_001645519         132 LVTNLDSEQTNRFEVFHRTSLNKSQVKKLAGTVINQSVTENIRVFLQAVGKIFAGEIIELALDARQKW------LLSKMD 205 Vanderw...
CCE89741             125 LVTNLDEQQTNRFEVFHRTSLNKTQVKKIAGMVINQSVTENIRVFLQAIGKLYAGEIIELALDVRQKW------LDGRMM 198 Torulas...
XP_002496997         144 LVTNLDEEQTNRFEVFHRTALSKTQVKKIAGMVINQSVTENMRVFLQAVGKIYAGEIIELALVVREKW------FVSRSV 217 Zygosac...
CCE83747              94 LIANFSNEQMERFESYRRMTVNKPGIKKVCTSVLNHSLPQNISVVLAGLSKSFLGEIITRALAVQEKE---NkAQLIKDI 170 Millero...
CCE42017             113 LITNFTNDQMERFEAYRRSTINKPGVKRICNGVVGHSVSQVIATVMAGVAKSFISEIISKSFEVQERD---NkGKLLSDI 189 Candida...
EDK44900             103 LITNLTNDQMERFEFYRRLTINKGGIKRICNGVVGHSIPQVLATVLAGVSKLFVSEIISGAFEVQERE---HkAKLLDDI 179 Loddero...
LoveMIT:GQ68_00285T0 132 LLENFDQDQMTRYEFFRRANVNKSVAKRIVQSVLGQSINNNVALLVSTVSKMFVGEMVEKAKEVQSR-RQKAqILEQISQ 210 Komagat...
6MZD_P               188 REAVR 192
XP_004180180         292 IQFDY 296 Tetrapisispora blattae CBS 6284
XP_003957609         194 IEFDR 198 Kazachstania africana CBS 2517
XP_001645519         206 IQYER 210 Vanderwaltozyma polyspora DSM 70294
CCE89741             199 IEFDR 203 Torulaspora delbrueckii
XP_002496997         218 LEFNR 222 Zygosaccharomyces rouxii
CCE83747             171 EEKkk 175 Millerozyma farinosa CBS 7064
CCE42017             190 ELKKK 194 Candida parapsilosis
EDK44900             180 QEKKR 184 Lodderomyces elongisporus NRRL YB-4239
LoveMIT:GQ68_00285T0 211 RKAai 215 Komagataella phaffii GS115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap