6GCS,6G2J


Conserved Protein Domain Family
ETC_C1_NDUFA5

?
pfam04716: ETC_C1_NDUFA5 
Click on image for an interactive view with Cn3D
ETC complex I subunit conserved region
Family of eukaryotic NADH-ubiquinone oxidoreductase subunits (EC:1.6.5.3) (EC:1.6.99.3) from complex I of the electron transport chain initially identified in Neurospora crassa as a 29.9 kDa protein. The conserved region is found at the N-terminus of the member proteins.
Statistics
?
PSSM-Id: 398407
Aligned: 113 rows
Threshold Bit Score: 50.5882
Threshold Setting Gi: 343425010
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GCS_F          35 GIYQHPNPRPALIALYEATLKELqDKH-PKDSVYRQSIENLTAHRKQIVEDNEVSEVIENKIGAGLIE 101 Yarrowia lipolytica
EGD75008        17 GLKRIVNAREVLESVYNDTSAVL-SKF-PEASAYRQKMLAITNDRLNLLKQSAEIHEFENALGQGQIE 82  Salpingoeca rosetta
jgi:OSTLU_9445   8 GLDVLDDAKATYEAICEEVLREVeVGI-PSDAGYREAVTKLYAERLAKVRAGGSVREIEDAIGEGQIE 74  Ostreococcus lucimarinus ...
XP_003064150    24 gLEPIADGRGALGAIVARVLTEVkTQI-PEEAGYRKVVESVYRHRQKIIEEVEDPAQIEARIGCGQIE 90  Micromonas pusilla CCMP1545
EFN53778        54 GLPVVPDAREELKAQLQAVLDAV-AII-PEHAEYRRSVEKTVRYKLSLASQADTPDEQLEELLSKQLE 119 Chlorella variabilis
Q6UKY3          53 HLSKEPGTRGKLIEALTEVLSSI-KAA-PEGSDYRKAVEASCIYRLKVCKENESDAAIEEVLDAHLEE 118 Chlamydomonas reinhardtii
Q23ND5          67 LLDVEPMPRAKIMKISYNILHKL-KEI-PETAMYRIYTEEKVKYIMKLTDEIEDVRQLEEEFGQDSIE 132 Tetrahymena thermophila S...
XP_004240712    24 GLEVVPNAREVLINLYRKTLEEI-KEV-PEDEGYRKAVESFTRHRLNVCVEEHESEMIEKRLGCGQVE 89  tomato
POM59529        20 GLKVNPNARQDLIKIYRRTLEEV-KILpPEAKNYRNAVEQITNFRLNVVETNEDEDVIERKINCGQLE 86  Phytophthora palmivora va...
XP_002128109    11 GLAVEANPRQKLNILYNNILSVV-SKI-PATASYRKYTEEFANQQLKKLDTIKDDVQLEIDLGPGQFE 76  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap