3CM1


Conserved Protein Domain Family
SsgA

?
pfam04686: SsgA 
Click on image for an interactive view with Cn3D
Streptomyces sporulation and cell division protein, SsgA
The precise function of SsgA is unknown. It has been found to be essential for spore formation, and to stimulate cell division.
Statistics
?
PSSM-Id: 398387
Aligned: 94 rows
Threshold Bit Score: 77.9641
Threshold Setting Gi: 503905951
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CM1_C        28 VARLDYSVD-DPYA-------IRAAFH---VGDDEPVEWIFARELLTVGIIRETGEGDVRIWPSQ-DGKeRXVNIALSSP 95  Thermobifida fu...
WP_013674840  22 VTRWSYDAR-DPFA-------VTFAVR---TRGDRWVEWLVARDLVVESLEGPAGHGHIRMSPQIvQGY-DIVEIEISSF 89  Pseudonocardia ...
WP_009152087  22 LSRLSYSAS-EPFT-------IALAFR---VEPGEWVEWEFARDLLIAGLSEVAGIGDVRIRPDLsGNR-DLLVLELESP 89  Saccharomonospo...
WP_012795693  22 LSRLTYVPG-APFT-------VTMAFK---VAPGEWVEWEFARDLLITGLHAPAGIGDIRIRPDLpGQSdDMLVIELESP 90  Saccharomonospo...
SDU54402      22 LSRLSFHAG-EPFA-------VTVSFR---TERGRWVEWTFARELLVTGLTDPAGLGDVRVRPDLsEDE-AMLTLEIESP 89  Amycolatopsis k...
EFG10169      53 TVCLLYSAD-DPFA-------VRMVFPpevSLSGAEVTWTFARSLLDEGLRTAAGGGDVRIRPCDr----SRTLVELRSA 120 Streptomyces cl...
EST24626      24 SVTLRYDSA-DPLA-------VRVAFPaevSRDDGEVVWAFARELLEAGLRTPSGDGDVRIWPCGr----AQTMLEFHSA 91  Streptomyces ni...
WP_003953803  26 RVALRYAPSeDPRA-------VHLTFPt-gTDFPSGTDWSLPLDVLENGLRAPARSGNVEVWPCGr----VQAVVEHHTA 93  Streptomyces cl...
Q9RKC9        28 PVVLRYDPQlDPSK-------VCVALPgrgGRASGSREWTFSRELLEQGLRAPAGSGEVRVWPCGr----VQAVVEFHSP 96  Streptomyces co...
WP_023417594  24 PVLLRY----DPDAargaerpVVLHFP---GAGFASPDREVPRALLEAGLRTTCTEGGVRVWPCGr----VQTVVEFHAP 92  unclassified St...
3CM1_C        96 -FGQARFHAQVAPLSEFLHRTYELVPAGQE 124 Thermobifida fusca YX
WP_013674840  90 -DGRAILEVDRDLLRSFVDATTELVALGDE 118 Pseudonocardia dioxanivorans
WP_009152087  90 -DGYAVVELSRVDVLRFIGRTVELVGLGVE 118 Saccharomonospora marina
WP_012795693  91 -DGYAAVEISRNDVQRFVDATLARVPLGYE 119 Saccharomonospora viridis
SDU54402      90 -DGYASFELEREDVETFLESTYDLVPLGSE 118 Amycolatopsis keratiniphila
EFG10169     121 -EGVALLRFATGRLRHFLLHAYTTVPAELE 149 Streptomyces clavuligerus ATCC 27064
EST24626      92 -DGVALTQFDTAVLRRFLRLTHQTVPAGEE 120 Streptomyces niveus NCIMB 11891
WP_003953803  94 -DGVDVVQFDSSALSRFIRHTYAAAagatl 122 Streptomyces clavuligerus
Q9RKC9        97 -QGCSVVQFENKALIRFLRRTYAATAQPva 125 Streptomyces coelicolor
WP_023417594  93 gEEPLVIQFDAVVLIRFLRRTHAEGPAGEp 122 unclassified Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap