Conserved Protein Domain Family
Bys1

?
pfam04681: Bys1 
Blastomyces yeast-phase-specific protein
The molecular function of this protein is not known. Its expression is specific to the high temperature, unicellular yeast morphology (as opposed to the lower temperature, multicellular mycelium form).
Statistics
?
PSSM-Id: 113449
View PSSM: pfam04681
Aligned: 2 rows
Threshold Bit Score: 301.169
Threshold Setting Gi: 74625038
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9P432  21 ESVVAKRADLGNAFVFIYCNFTVFLDVEAGGVSTRRTLNGRNHDYYHEPYGGGSGDGVSLTLSHTEGRDSSNSRTTFRYK 100 Blastomyces dermatitidis
Q9P434  21 ESVIAKRADLGSAFVLVYCNFSVALDIQAGETSTRKILDGRSYDYHNEKYRPGSGDGVSLTLHHTDGPDSSNSETTFRYK 100 Blastomyces dermatitidis
Q9P432 101 LSDGNSTVGYSLGNSGGNPFEGHKLTLKPSDDRCPRIEWPDGIPTGVSSGSCGSGANLILTMCPLERPRQEFEDE 175 Blastomyces dermatitidis
Q9P434 101 LADDNSTVEYSLGNSGGNPFAGHKITLKSSGDGCPSIEWPEGIPTGVSSGSCGSSENLILTLCPPGTSLDDFEDE 175 Blastomyces dermatitidis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap